CAZyme Information: MGYG000000391_00693

Basic Information

• Species: UBA11475 sp003538975
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA11475; UBA11475 sp003538975
• CAZyme ID: MGYG000000391_00693
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000391_2|CGC2	68827.22	8.8404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000391	1644097	MAG	Sweden	Europe

• Gene Location: Start: 229023; End: 230846 Strand: +

Full Sequence      

MEKKTGKKNVEKVAQKQENSLKEQTVTATKTEKILAVKPAARAEEAKKDEKTVKTAAKKT
VKKTGTKAATKPGQEVKSEALPVKEASGKTTEKATKTKKTTVKTGTKKETPSKAETKTET
KVENTEKPVEKITVTKKRSVVFIGSEAAPFIATGGLADVLGSLPEAISENGNYDVSVILP
MYSAINYEWRKNFEYVTNFSVNLSWRTQYCGVFRYVYRGVTFYFLDNEYYFKRDGKIYGH
YDDAERFAFFSKAALDTIARLDIYPDVVHCNDWQTAPAIIYLKGMYYPDERFRRIKTVFT
IHNIEYQGKYGMELYGDLFGFDPSLYNYVEYESCINLMKGAIEMSDKVTTVSPTYANEIK
DPYFAHGLENVIKRNAFKLSGILNGIDYEYYNPATDTHIEKNYSVNDMSGKKVCKTALQK
LLNLPEREDVPLTAMVSRLVSHKGLDLVKGVIEQYLSEDVQFVLLGTGEAEYENYFRYLQ
NAYPDKVRAIIAFNLDLSRKVYAGSDIFLMPSRNEPCGLSQMIASRYGTVSVVRETGGLN
DSIKAFYEGNGNGFTFKDYNAYDMLYVLREAKNCYYDKALWGKAVANAMNSDFSWKNSAT
EYEKLYD

Enzyme Prediction     

No EC number prediction in MGYG000000391_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	140	606	6.6e-177	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	140	606	2	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	140	606	3	460	glycogen synthase GlgA.
COG0297	GlgA	0.0	140	606	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	140	606	3	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	5.68e-105	139	606	5	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60006.1	2.89e-170	140	606	3	469
QNO18264.1	1.28e-168	140	606	3	468
QEY34691.1	8.94e-167	140	606	3	468
CBL34072.1	4.92e-166	140	606	3	468
CBK95754.1	1.40e-165	140	606	3	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	4.54e-82	126	607	117	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	1.78e-80	140	606	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	9.39e-78	140	606	3	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.19e-77	140	606	3	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.41e-76	140	606	3	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V049	5.37e-151	140	606	3	472	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	1.52e-150	140	606	3	472	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A0PY73	6.30e-150	139	606	2	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
A6M334	1.26e-149	140	606	3	472	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
B7GK04	1.49e-149	140	607	3	472	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000391_00693.