CAZyme Information: MGYG000000392_01582

Basic Information

• Species: Ruminococcus_E sp003521625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp003521625
• CAZyme ID: MGYG000000392_01582
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000000392_10|CGC2	27567.67	8.8214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000392	2042501	MAG	Sweden	Europe

• Gene Location: Start: 38198; End: 38899 Strand: +

Full Sequence      

MIPKVIHYCWFGRGEKPKLAKKCIASWKKYCHDYEIIEWNEDNFDINQNEYTKMCYDQKK
YAFLTDYVRLIVVQKYGGIYFDTDVEVVRNFDDLLDNIAFFGFETNEYVNTGLGFGAEKE
NEIVKQMIREYDRLLDGKNGMIGCPTLNTKALLKFGLVQNGDKQRIDKAVVYPKEYFNPR
DSATGDLKRTDNTYSIHWYSMSWLPKRLRIRSKITRVFHRLFGVNCFSVLKKD

Enzyme Prediction     

No EC number prediction in MGYG000000392_01582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	97	4.7e-23	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.00e-17	1	97	81	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	1.28e-13	1	136	45	200	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	1.45e-13	17	101	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam12919	TcdA_TcdB	0.007	41	84	140	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU77720.1	2.92e-111	1	223	1	223
QJU16510.1	2.92e-111	1	223	1	223
ASU30521.1	2.92e-111	1	223	1	223
QQQ95316.1	2.92e-111	1	223	1	223
QUO34420.1	1.81e-88	1	221	1	225

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000392_01582.