CAZyme Information: MGYG000000393_00670

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000393_00670
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000000393_60|CGC1	84731.86	5.0637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000393	2242585	MAG	Sweden	Europe

• Gene Location: Start: 5427; End: 7673 Strand: +

Full Sequence      

MKKTVFLATLAVLFYWTNTSAQMQMVKNGKAKSRIVITTGEKADSTAAELLQDFVRRISG
AELPVTGNIQDPKSFRKGDILIGNGLEHILFSLPDGGKASDGLKDDGFRLLTDNGMLRIA
SGGDKGSIYGVVTLLEKYLGVNYWGENEYSLTEHTDITLPEINEIDNPAFRYRQSQFYGM
KNDPVYKLWMRLDEPAEMFAGGYWVHTFDRLLPSSRYGAEHPEYYSWFGGKRHPGKASQW
CLSNPEVFEIVCERIDSIFKANPGLDMISVSQNDGNYTNCQCDECKAVDEYEGALSGSLI
RFVNKLAERFPDKEFSTLAYLYTMKPPKHVKPLPNVNIMLCDIDCDREVSLRENASGREF
VEAIEGWSKISDNIFVWDYGINFDNYLAPFPNFHILADNIRLFRDNGANMHFSQIAGSRG
GDFAEMRTWIVSKLMWNPDRDTDELIHTFLDGYYGDAAPYLYQYIKVMEGALIGSGQRLW
IYDSPVSHKRGMLKPELMRRYSALFDSAEKAVAEDSVRLSRVRRTRLPLLYSELEIARSE
KNMSPDELKTKLDYFESQVKFFNVPTLNERNNSPVEYCELFRSRYMPRPVKSLAEGAKVI
FIDSPEASYAALGSTALTDGLFGGAGFVEGWVGWEGRDASFVIDLGEVKEISSVETDFLH
QLGAWVLLPAGVSYEISLDGENYTQASSKELPEDRNPKIQFVGVRHDFDTPTEARYIKVN
VTGTKTCPHWHYGVGHPCWFFVDEVTVL

Enzyme Prediction     

No EC number prediction in MGYG000000393_00670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	211	465	1.3e-107	0.9960159362549801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	4.89e-137	204	465	1	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
pfam00754	F5_F8_type_C	1.65e-11	616	726	16	117	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	3.24e-05	30	135	21	105	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
cd00057	FA58C	0.001	630	738	36	136	Substituted updates: Jan 31, 2002
cd14791	GH36	0.002	213	315	92	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA50059.1	0.0	10	747	18	740
QUT70943.1	0.0	10	747	10	732
AAO76142.1	0.0	20	747	24	733
QMW88052.1	0.0	20	747	24	733
ALJ42190.1	0.0	20	747	24	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	2.23e-18	583	747	607	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000352	0.998919	0.000219	0.000159	0.000166	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000393_00670.