CAZyme Information: MGYG000000393_01032

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000393_01032
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		52983.81	5.752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000393	2242585	MAG	Sweden	Europe

• Gene Location: Start: 1088; End: 2479 Strand: -

Full Sequence      

MNRKRLLLLSAGLSACLSSFAQIEIDFSEEVGEIKLMNAVNNGPVVEKKVQKSGNFRAYS
DAGFPYARLHDAPIRRDWAHTVDVSCVFPDFSADEEDPRSYDFTLTDKLLKEIQASGTKV
FYRLGQSIEHWPKKYDVMPPADFRKWARICEHIVLHYNYGWADGFNMGIEYWEIWNEPDL
GHRAGRHLRNDSPTWNGSDTDFFRFYETAYRHLKKCFPELKFGGPALCEDNEWAERFLEY
MSSKRVGLDFFSYHLYAGTAGAFQKKNALMKELLDRYGYGDVEMILDEWNYLSNWTDEFV
YTLETVQSHKGAAFTAAVMSVCQDGPADMLMYYDARPGTGFNGLFAFSTSKPLPAYYAMY
SWKKLLALGTQVRSTAGGLEDIYVTAAKGEDGRNAALITYYTDDRDPVAPVRVTVDFRGC
RIREAVGHITDKNHLHTEVPVHIIDGKAELFLEVNSYIFIETR

Enzyme Prediction     

No EC number prediction in MGYG000000393_01032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	61	419	3.7e-39	0.8352668213457076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.41e-17	58	368	42	349	Glycosyl hydrolases family 39.
cd21510	agarase_cat	2.66e-04	170	256	100	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
cd06542	GH18_EndoS-like	0.008	82	179	28	122	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD82796.1	2.46e-72	23	459	3	436
QTH43246.1	6.66e-72	32	401	12	379
QJD85864.1	7.82e-72	21	456	2	441
AVM69820.1	1.67e-71	23	441	3	426
AVM46100.1	1.67e-68	26	408	7	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z3K_A	1.09e-33	77	342	58	311	Crystalstructure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus],5Z3K_B Crystal structure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus]
6YYH_A	2.03e-14	101	258	100	255	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001493	0.555742	0.441058	0.000691	0.000578	0.000415

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000393_01032.