CAZyme Information: MGYG000000394_01808

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000394_01808
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000000394_37|CGC1	39541.27	5.1792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000394	1906398	MAG	Sweden	Europe

• Gene Location: Start: 3033; End: 4112 Strand: -

Full Sequence      

MSSRPIQAAILSVEGLRLNDNEKSLLEKSNPLGVTLFGRNIADKEQVRSLVKEIREVIGR
NDVLIATDQEGGRVRRLREPEYIAYASQNTLGKLAEEKGLAAAMRAVISHSLLTANDLKE
NLINFNYAPVLDLAYPDTNPVLKSRSFGSDKQLAAELGNLMLEEYVINGICPCIKHLPGH
GRAKADPHLELPVIDCSLKELENDFYPFQKLNFAPAGMTAHLLITAVDDQKPITQSKKGI
DTVIRGIIGFDGLLLSDAIDMHALKGTIGERTALSVAAGCDVVCYCLGNYQELLQVTENC
GFMTDKAMERFQTVRDIIGSSALEKAATEYQKLIGEIETYDDTYDATETLNKMKHKGEK

Enzyme Prediction     

No EC number prediction in MGYG000000394_01808.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	284	1.7e-32	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.98e-65	7	296	6	290	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	2.72e-54	10	286	5	280	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	9.77e-49	12	314	13	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10689.1	1.13e-115	8	353	4	337
APE27056.1	4.32e-78	9	336	4	337
QYA06891.1	4.71e-77	7	314	5	312
QCI97664.1	4.71e-77	7	314	5	312
AKQ42648.1	9.70e-77	9	322	4	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G6C_A	1.49e-40	10	338	15	335	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	1.56e-40	10	338	17	337	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]
3TEV_A	3.10e-40	4	283	17	290	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3WO8_A	1.52e-36	19	293	28	292	Crystalstructure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]
6K5J_A	2.20e-36	7	283	19	296	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2KXM7	1.46e-42	5	286	11	293	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
C4LEY6	1.63e-39	10	286	5	277	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q7VWV8	9.22e-39	5	286	12	294	Beta-hexosaminidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=nagZ PE=3 SV=1
Q7W9J5	9.42e-39	5	286	12	294	Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=nagZ PE=3 SV=2
Q7WH65	9.42e-39	5	286	12	294	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000394_01808.