CAZyme Information: MGYG000000395_00030

Basic Information

• Species: CAG-217 sp900547275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-217; CAG-217 sp900547275
• CAZyme ID: MGYG000000395_00030
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000395_1|CGC1	45507.5	4.4661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000395	2097770	MAG	Sweden	Europe

• Gene Location: Start: 30990; End: 32162 Strand: -

Full Sequence      

MFVQGVNLGNWLVLEKWMSPGLYNGTTAEDEYYLPTQLSPEVYEARIRAHRSEYISERDF
AIIKSLGLDTVRIPVPYFIFGDCPPFIGCVEELDKAFAWAKKYGLKILIDLHTAPLSQNG
FDNGGISGVCVWSQRPELVEFELSVLERLAERYGNHEAMWGIELLNEPITEPMWSQMGIQ
ERYVPVDKELGAQSKPNTFEFIEQFYKDGYDRVRKYLPEDKYVVIHDAFDFKRWKNFMRE
DKYKNVVLDTHLYLMMAEMFGCDQTVESYEEYIRDHFAKDMEEMEEYFPCICGEWCLFNS
YACGVDTHGGQTVLNGQENASTETFNEEQKKEIYSRLNKAQIAAWKKGSGYFYWTYKMLL
DTVNENGWIGWDAWDLGKCAAMGWFEADNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	357	2.5e-137	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	9.83e-23	3	190	18	215	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	9.06e-05	30	168	2	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU75476.1	1.72e-218	1	388	1	388
QQQ93046.1	1.72e-218	1	388	1	388
ASU28285.1	1.72e-218	1	388	1	388
QJU14366.1	2.83e-217	1	388	1	388
QBE98393.1	2.50e-216	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	4.34e-181	1	385	1	386	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	3.54e-180	1	385	1	386	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.97e-41	3	357	13	372	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	5.70e-40	3	368	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	1.53e-39	3	368	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B5X8	4.24e-48	3	376	29	384	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q875R9	6.48e-47	3	385	48	424	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
D4AJL7	1.49e-45	2	376	33	393	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
Q7Z9L3	9.29e-45	3	376	31	386	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	9.29e-45	3	376	31	386	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000395_00030.