CAZyme Information: MGYG000000395_00226

Basic Information

• Species: CAG-217 sp900547275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-217; CAG-217 sp900547275
• CAZyme ID: MGYG000000395_00226
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000000395_1|CGC5	89108.02	4.8185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000395	2097770	MAG	Sweden	Europe

• Gene Location: Start: 210294; End: 212744 Strand: -

Full Sequence      

MKHAEIVQKMSLEQKAAFVSGFDYWHLEEAPELGLPKIMVTDGPHGLRKQNPNGDSVGLG
NSYPATSFPTAATSSCSWDEDLLKQEGEALGEECLKEEVSVILGPGTNIKRSPVCGRNFE
YFSEDPYLSGKCSAGWIKGVQSKGIGTSLKHFACNSQEAYRMIVNEVVDERALRELYLTA
FEIAIKEAQPWTVMNSYNRINGVYASQNGWLQEQVARKEWGFKGLFVTDWGSSVDRIPGL
ENGTDLEMPSSGTLNTEKIIAAVKSGELDENVLNERVDNVVDLIVKSKEVLSQKYTYDID
AHHELACRVAEGSIQLLKNDEDILPLKSGQKVAVIGEMAKAPRYQGAGSSVINPTKMENA
YDNLVALGVDVTYAQGYEKGKDVVNDALVSEAVEAAKKADVAIVFAGLTEEFEAEGYDRD
DINMPSSHNSLIEKIAEANPNTVVVLAGGSVVLMPWIDSVKGLLNSGLSGQAGGKAVANI
LVGKVNPSGKTSETYPLSFEDNPTFGNYPGQPVVSEHKESVYIGYRYYDTAGKDVLFPFG
HGLSYTKFEYSDINLSSANIKDTDELTVTFKIKNVGERDGAEVAQVYVADKESTIFRPVK
ELKGFAKVFLKAGEEKEVSITLGKRAFAFYNVDLQDWQVETGLFDIMVGASSRDIRLAKA
VNIISECEAKIPDYHQSAPAYYTADISAIDDAQWTAVYGKELPARQRDTSKPIDIYCCLD
DASHTKWGGKLCRIINKMMKKFGSAENGDGAMLAAMATQIPIRNFIAMSMGVFSPKMADG
LLMILNDDKSTFVGFNKILGGIGGALKKLPNLLKSI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	1.2e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.81e-102	66	656	118	758	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	1.92e-64	316	545	3	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.78e-63	30	622	76	742	Probable beta-xylosidase; Provisional
COG1472	BglX	6.27e-59	29	336	54	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam14310	Fn3-like	1.45e-32	582	652	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	1.78e-275	1	791	1	791
AGS53563.1	3.61e-270	1	791	1	792
QEN03854.1	7.95e-268	5	788	7	795
QSX09143.1	9.17e-263	2	788	3	795
AEF82048.1	1.22e-262	1	786	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.35e-252	5	665	7	670	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.50e-215	7	669	9	669	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.90e-141	5	666	6	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.06e-139	5	666	6	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.87e-119	5	666	8	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.30e-251	5	787	7	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.62e-211	7	670	9	677	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	8.18e-210	7	661	9	670	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	7.89e-136	5	656	48	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	2.04e-130	6	655	14	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000395_00226.