CAZyme Information: MGYG000000398_00359

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000398_00359
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000000398_2|CGC2	36899.43	9.321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000398	2936252	MAG	Sweden	Europe

• Gene Location: Start: 126040; End: 127026 Strand: +

Full Sequence      

MKENRNRIFVVTVIVVLLLIGVGCAVSYEGYTKKKETVRKMGQQSGGQSVTKEIPETPIP
SAASWSIAKQSGRKEDFEAYFKRDLDAYTKERNVPKGKMKKVYYYSKVIGEKREVYVYTP
PQYSKHKKYPVLYLLHGIGCDGSQWISMKADNVLDNMIADGESTPCVVVCPSITPKKNKR
TTQAISPENIEAYEKFDRELTGDLMPFINSHYNVSDKRKDTAVAGLSMGGMESLLVGFTH
LNRFNYIGSFSAAPSLDTSLLKLTKHSRKPKLILLCSGTSDSTVGDIPEGYHNILTENRV
DHIWYLYPDGGHSYEVWLSGLINLLLRM

Enzyme Prediction     

No EC number prediction in MGYG000000398_00359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	106	320	9.4e-46	0.9427312775330396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.38e-35	84	328	54	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.10e-22	106	328	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	4.07e-18	106	327	16	257	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0627	FrmB	2.47e-13	117	317	39	297	S-formylglutathione hydrolase FrmB [Defense mechanisms].
PRK10439	PRK10439	1.97e-05	103	322	184	400	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL52399.1	5.00e-67	93	328	74	321
QEH70018.1	4.05e-60	97	323	228	466
ADZ84563.1	3.10e-59	97	323	228	466
QDY84819.1	2.40e-58	83	328	51	297
QYK64837.1	1.34e-57	83	328	51	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JJF_A	1.99e-49	88	325	20	254	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	5.55e-49	88	325	20	254	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
5CXU_A	4.68e-41	89	325	16	266	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
7B5V_A	2.94e-28	88	321	128	377	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	7.89e-28	58	317	80	331	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	5.41e-45	88	325	39	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	2.66e-24	87	317	131	376	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	2.66e-23	86	253	418	589	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	3.41e-17	83	285	484	683	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	1.55e-07	109	250	837	974	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.028016	0.002058	0.969913	0.000006	0.000007	0.000009

TMHMM  Annotations     

start	end
9	31