CAZyme Information: MGYG000000398_01736

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000398_01736
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914		102015.7	9.1184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000398	2936252	MAG	Sweden	Europe

• Gene Location: Start: 83866; End: 86610 Strand: -

Full Sequence      

MKKGINRVKMGIKALIGVIGGYLGVVSTILGTMLGILASILVVCLIAGICVYVKVIPMFT
EAREVVFDNLVNMTEEDFVMNEDTQVFDDKGKKIGSVNAGRFKYTKISKISPYIYNGYIA
VEDKRFKTHGGVDLLATMRASVALLKNRGEITQGGSTITQQVIKNNLLSQEQTFTRKVAE
ILLAPSVEQKFGKDKIMEFYCNSNYYGNRCYGVASASKYYFGKKPADLEPAEAAILIGLS
NSPAAYNPVAHPKEAKQKRNEVLLKMYEGGAITRKEYKKAVKTKLQVLQLAEKTANESYL
LSYAVHCAALSLMEKENFQFKYTFKTKKEYETYQAKYASVYSAKCDDIRSGGYKLYTSLN
QKKQKKLQAAVDHGLAYNTEKNADSGKYALQGAAVCVDNNTNYVVAVVGGRGTKDAYNRA
YLSARQSGSSIKPLIDYAPGFESGKFSPSTVVNDHAIKNGPKNSGGGYRGNVHVREAVAR
SINTIAWQVLEAITPEYGLSFLDKMHFHNLSYVDNGNMALSLGGFTEGVRVVDMAKGYAT
LANNGEYSDRTCIKKISHVSDGVIYKDAEEKTQVYSKGAAWMMTDVLKGVFNESYGTARA
LKLNGGQITAGKTGTTNSSKDVWFCGYSAYYTTVVWCGYDTPRAMPGTYGATLSGAIWKN
YMNQIHQNLAPKDFEKPETVCLAKYDSKGHIIEGTEVTGDRKRSYGMDYFATDILEDTTE
YVDHETDQSRQNKAKSKLEKFEKLTITSIADYYTFTETYNTLKNMIAVIKDDDVRKEYST
RCKDKYDSLKDESVKWKDVVKAYEQQRSEENQRLADAASAKAKREREALTKKTRIALAQT
RLKKLTGYEYQPENMNDLLKKAEQAVEACKPYSEYNELHGDYIRNRQKIQALPTKEQYDA
DDQENTSGTDNNAE

Enzyme Prediction     

No EC number prediction in MGYG000000398_01736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	91	267	9.2e-58	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.10e-157	104	668	4	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.22e-154	84	678	56	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.47e-129	29	732	4	779	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	6.02e-82	113	689	158	704	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	9.12e-77	84	677	37	571	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92626.1	3.86e-267	51	900	52	885
QJU21747.1	1.55e-266	51	900	52	885
QRP41393.1	6.19e-266	51	900	52	885
ASN93939.1	6.19e-266	51	900	52	885
QQQ98855.1	4.97e-265	51	900	52	885

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	5.24e-58	85	662	22	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	8.08e-57	85	680	9	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG8_B	5.63e-55	187	640	3	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3UDF_A	2.86e-54	109	667	46	717	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
2OLU_A	7.55e-54	85	680	18	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	6.60e-78	81	738	54	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	6.60e-78	81	738	54	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	5.85e-77	81	738	54	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
P38050	2.46e-76	75	640	40	571	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P40750	2.41e-75	72	659	44	617	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991870	0.008080	0.000022	0.000013	0.000009	0.000026

TMHMM  Annotations     

start	end
21	53