CAZyme Information: MGYG000000399_00721

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae
• CAZyme ID: MGYG000000399_00721
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000000399_10|CGC1	70964.67	5.0152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000399	1208519	MAG	Sweden	Europe

• Gene Location: Start: 15380; End: 17248 Strand: +

Full Sequence      

MKKIMQATKIWTNNPDTIDEYVDFKSEFSCTAGEKIFLDISCDNVFNVYLNGENAGFGSC
QNFIGSLQYYTFDITRLCKEHNDLAFTVWHFGEDSSTYIKQPAYLMFRVRQGENILLTSD
KNVLCAPNPNFKSGRAQLITVQLGFGFYYDNSVNDERNFVPSAEYGEAEAEYNNILNLKM
LKRSTAKIRKTDYGYLIDMKKETVGFLDLELNATEEEEILICYGERLDENGRVPRIIENR
DFSLFYKSRKGANAYVNTFRRIAGRYLEIHTKSSEVVYAGIRPVMYPSVIVEKSIPDKTL
QKIYDISVYTLRCCMHEHYEDCPWREQALYALDSRNQMLCGYYAFRGYQFQRASLILLAK
GLLDNGLLNICAPAGFVKPIPSFSLIYPVQVYEYITYSGDKSILNEVGDALRAIMNTFSS
AIDETGLIPDFEDPCWNFYEWSDHNDYLPAKVEIGGTVVKNYDLILNCMYVYAAGYYDKI
FRISTDTTAIKKAIKANFFVEGKQEFKLSTTGEEHFGVLGNAFAILAGVGSKALAEKLIN
DKTLIPATLSMNAFVYDALLQSGNQYKEYILTDIKTRYNRMIARGATTFWETEKGAEDFN
NAGSLCHGWSAMPVFYLNELID

Enzyme Prediction     

No EC number prediction in MGYG000000399_00721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	193	616	1.6e-57	0.8492063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.28e-16	297	611	10	330	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.001	195	270	8	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	8.41e-109	3	620	7	707
QNK57365.1	1.80e-90	1	616	1	708
QGQ97405.1	1.44e-88	1	616	3	709
ARN56684.1	5.67e-78	10	621	26	712
AQQ71631.1	2.38e-69	2	621	4	692

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000399_00721.