CAZyme Information: MGYG000000400_00583

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000000400_00583
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000000400_8|CGC2	75729.92	5.8583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000400	2908659	MAG	Sweden	Europe

• Gene Location: Start: 61913; End: 63952 Strand: -

Full Sequence      

MTSNRKGLQAIFSIVFAATFLSGTLHMEGAVKNFTAGNWELRVDDTDGSVDILRDGAPVV
AGSRSVWGIDSLRRDMGSLGRLSATSAHFSDKFGDGTVVTISGKEGKLKVMQRYYLYPDK
DYMLTDFSVSSPEGVELNYMAPVSSCARYEAFSRPGNSILFIPYDNDAWVRYRITPFGEP
APESYEMSAMLNTDTREATVLGSVEHDVWKTGVKLVTYGASAVDSVTVYGGAASALTRDV
RPHGAVKGNSVKSPKIMIGRYADWCDGMEAYADLCAIQAPRIASCGERPFGWNSWGKLQT
KINYKNASEVAEFIGSLRDDSFLNADSTVYIGLDSFWDFGFNRDELRAFARECHVRGQKA
GIYFCPFTDWGKNPEVTVAEAPQYKWKDLYLTHNGEPLSFDGAYAIDPTHPGTKARIRKQ
IDEFKEWGYDFMKIDFMAHGAYESDRHYDPSVTTGVQAYNHGMAYIDSVADGKLWINLSI
APLFPANYAHSRRIGCDAWADINNTEYSLNALTYGWWLDHVYHYNDADHIVMEGVTDGEN
RARLTSSAITGLFLLGDDLSTTGEPATRDKVRRTASNPCINEIARKCKSFRPVEPGTGDR
ATDMFTYDTGKEIYLAVFNFGDRSERKHLPLHRLGLSDGVEYQATELWSRDLLKLRGALD
TELPAKDVKVYRIEATARH

Enzyme Prediction     

No EC number prediction in MGYG000000400_00583.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.33e-17	287	559	1	279	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	3.81e-12	289	561	2	251	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	4.40e-07	612	673	15	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02692	PLN02692	8.43e-05	289	435	57	177	alpha-galactosidase
COG3345	GalA	0.002	269	465	272	496	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT74245.1	8.86e-195	32	670	15	652
ALJ44661.1	1.04e-189	32	670	32	669
AAO78239.1	1.23e-189	32	670	16	653
BCA52469.1	1.23e-189	32	670	16	653
QMW89149.1	1.23e-189	32	670	16	653

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.108016	0.760470	0.127298	0.003035	0.000691	0.000473

TMHMM  Annotations     

start	end
7	26