CAZyme Information: MGYG000000400_00947

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000000400_00947
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000000400_15|CGC1	76037.06	4.6807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000400	2908659	MAG	Sweden	Europe

• Gene Location: Start: 4131; End: 6176 Strand: -

Full Sequence      

MKLIKILAASALALGMTMNAGAAVTVVDRPLDGTSNNYTNFRAPLRQAPLLKLPVGKVQP
KGWLRKYLELQRDGLNGHLGEISAWLDKKNNQWLSDNGDHGWEEVPYWLRGYSSLAYILD
DEAMKQEAQVWFEAVLTNLKADGFLGPRNYENGNPELWAQMVMLWALQTYYEATGDERVI
PAMTNYMKWELTVPDSKFLKGLWQEKRGGDNLWSMLWLYNRTGDADLLPLAEKLHNNTSN
WAMEGTLPNWHGVNVAQGFREPATYYMYSGDEAMLKATYNAFDEMRKRYGQMPGGMYAAD
ENARLGYFDPRQGAETCAVVEQMASDEILMGITGDPFWADHCENVALNTFTASMTPDMKA
LRYLTAPNMAISDEKLHGPSIDNNLRGMLSMSPFSSRCCQHNHGMGWPYYAEHLVMATAD
NGLATMLYAASATTAKVADNQEITLTETTNYPFDETVTLTVGTGADVEFPLYLRIPAWAK
GCTVAVNGEPQAVADAQGRYVRIARTWADGDVVTLTLPMTVSSQVWQQNKASVSVNYGPL
TLSLAVDEISEQHDSRDTQFVQDDSHWQEGVDASLWPCYVLRTDSPWNYALKVDKDNLPL
NFSVAKKAWPADDFPFTPENVPLEFTAVGVQIPSWGLDATGMTDLLPTRYAPRATDETPL
KLLPMGAARLRIAAFPREVVK

Enzyme Prediction     

No EC number prediction in MGYG000000400_00947.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	193	542	4e-39	0.6679920477137177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.88e-100	23	543	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.36e-27	154	521	127	478	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07470	Glyco_hydro_88	0.005	85	228	1	151	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADJ45365.1	3.62e-167	9	676	14	660
AFO77076.1	3.62e-167	9	676	14	660
AEK42125.1	3.62e-167	9	676	14	660
AGT84204.1	3.62e-167	9	676	14	660
BCJ47054.1	9.74e-163	34	676	26	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.26e-20	104	544	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.99e-18	104	544	78	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	3.01e-14	312	543	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	6.25e-13	312	543	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.998760	0.000194	0.000230	0.000198	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000400_00947.