CAZyme Information: MGYG000000400_01151

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000000400_01151
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MGYG000000400_19|CGC1	68777.89	5.5406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000400	2908659	MAG	Sweden	Europe

• Gene Location: Start: 47762; End: 49612 Strand: +

Full Sequence      

MKRLSLIIAAVALYAAASAEISSKLNGYIGSRIDSCIENMVKARDTEPLVEPFRHLGEKG
GWQTEFVGKWMLGAMASYRYNHDPELLGKINNTVTALIATQHSDGYIGNYELDDRLNAGW
DIWGRKYTSLALLDHYALTGEKSSLEAARRLIDGLMDELKSQNKDIASTGNYRGMPSSSI
LEPVMYLYRASGDSRYLDFACYIGESLDSPDGPGLVTKALKGVPVAHRFDFPKNWWTYEN
GQKAYEMMSCYVGLIELGKTIGRSDYIQAACAVADNILATEINIAGSGAAFECWYNGKDR
QTTPAYHTMETCVTFTWMQFLNKLWQQTHQSRYVDEFERTMYNALMAALKDDAHQISKYS
PLEGRRQAGEEQCGLPINCCSANGPRAFAMIPDFAVEQSADTIWVNLYLPGTYQLESGRN
KISLDIKPDFPVSGNTSISMTMTKQQKMVMALRVPGWSHGHYSVTVDGTQTAASDSTGYI
YVSRKFGRNTEMALDFALDTRLVELNGMQSVVRGPLLFARDSRFGDGYVDECCVIQADGN
GIVETRFAENPVPWAWVTLEVPAVLGTDLEDPANSTVKYMRMCDFSSAGSDWCRTGRYRV
WLTKTLNAMAQPYQKY

Enzyme Prediction     

No EC number prediction in MGYG000000400_01151.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	63	518	1.6e-51	0.8969465648854962

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.47e-51	29	519	21	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.01e-38	22	565	16	528	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	1.06e-04	78	215	99	244	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	7.11e-04	131	208	419	501	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.32e-231	24	616	28	620
QUR48577.1	3.59e-34	22	550	48	577
QIX65272.1	6.53e-34	22	550	48	577
BBK93301.1	8.81e-34	22	550	48	577
SCM56172.1	9.01e-34	22	518	49	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WRE_A	9.41e-27	62	545	73	604	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	9.74e-27	62	545	73	604	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	9.74e-27	62	545	73	604	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	2.12e-24	62	545	73	604	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.15e-26	62	545	73	604	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000208	0.999189	0.000152	0.000159	0.000143	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000400_01151.