CAZyme Information: MGYG000000402_00684

Basic Information

• Species: Pseudoruminococcus sp902765855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Pseudoruminococcus; Pseudoruminococcus sp902765855
• CAZyme ID: MGYG000000402_00684
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875	MGYG000000402_4|CGC2	93932.86	9.9025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000402	1550033	MAG	Sweden	Europe

• Gene Location: Start: 151807; End: 154434 Strand: +

Full Sequence      

MHAKRLAPEIKPMKPRFAIRTKIIASFCAFMLAASVTVTAIPSTTANADTYVMATSTVYL
NVRESATTSSAVITTIDPDTKVTVIGDRNKDWVHVKLNDGRTGYCFAEYLKIDDVSIKLS
RSSRDLAIGSTKNMPVTSSCSSNNIKWTSSNTKVMKVDQNGNMTGVSAGTAIVTATNQIT
GGSSTAKITVKHPDFDKIYVDPPKKISIGSSVNVNAKASKEGGKLYYFTSDSTIAKITSN
GVIKGIKAGRVRVRVTESTGTISKFFYIDVVEPVATSVSLSPSTAKVAVDAKKTLTAKVS
PVAADITYKSSNTSTVKVDKSGEYKGVHEGTATISASNSQGKVLATAKVTVKYPDYSSIT
LTNAPSSVTVGKSFNVGAKTSTGSGKIYHRSSDTSVATISADGTVKALKAGTARIYSYDD
TGSVYKNFNLNVVPNSSVTLSKTSATITRGENVKLTATVKPSGSVTWSSSNTSVATVRNG
VVSGLRKGTATITAKTSAGATASCKITVNDVYSNGKISLNQTSATVNRTRTLYLEGYSSS
GITWTSSDPSIATVSDGFVTTKEVGQVAITAKDSNGNKAVCVVNVLAATPLKFTYTNPNS
ATLNSTVTFIAITDKKRTAVKFNVTVGDKTYVVNATSKTSDCNDYIWKGTLKMTKSGTFN
YTAYAYLNNKWSTCSDAKGTVFVSNVTSKSTTAIQSLRASNDLISFIAEKEGFLSHYERD
QMAYDPVPTVGYGVVVYPGDIFYNSLTKNEAYAWLVKEVNEGAYTSAINRFSKNNNIKIN
QYQFDALVSFSYNLGTGWTYGGWDIYDFLTSYSDLNKVNQTKLVNTFAVYHHAGGQLYWG
LYYRRIDEAEMFLKGDYISDGYNNKYGFNISTCCV

Enzyme Prediction     

No EC number prediction in MGYG000000402_00684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	700	848	4.3e-19	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	7.80e-23	704	853	2	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG5492	YjdB	6.61e-16	296	581	61	329	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
COG3772	RrrD	1.75e-14	698	857	6	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam08239	SH3_3	1.33e-13	60	111	3	54	Bacterial SH3 domain.
cd16901	lyz_P1	4.53e-11	698	848	1	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT44110.1	2.23e-34	116	585	318	766
VCV21496.1	2.55e-24	68	508	1486	1855
CBL14115.1	2.52e-19	68	416	694	1048
CBL09766.1	2.50e-17	68	415	1486	1839
ADL41706.1	5.56e-15	693	857	101	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.69e-06	700	854	53	195	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q086E4	1.75e-14	137	611	72	585	Ice-binding protein 1 OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=Sfri_1018 PE=1 SV=1
P33747	1.38e-07	429	585	31	199	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2
Q37896	1.86e-06	723	856	21	146	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004789	0.994066	0.000403	0.000329	0.000214	0.000195

TMHMM  Annotations     

start	end
23	45