CAZyme Information: MGYG000000403_01160

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000000403_01160
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		25772.27	6.6403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000403	2138464	MAG	Sweden	Europe

• Gene Location: Start: 257; End: 934 Strand: +

Full Sequence      

MIHSFLIIGQSNMAGRGKLDEAQPLDNDKLLVLRNGRWQPMYRPENNDRPFSGVCLAESF
ARLYADENNIMTGIIPCADGDTSLYDWQEGSLLYDNAVEQTRLARRTSKIAGVLWHQGEA
DCRPERYPFYEANLAQFIRALRRDLNLFDVPFVLGELGEYLESHPAENLKNYKYINAALA
HYVKNTPMTGLASSKGLTPNPDILHFNTKSLMEFGKRYYEVFKRL

Enzyme Prediction     

No EC number prediction in MGYG000000403_01160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	56	146	6.2e-22	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	1.44e-60	5	222	5	224	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXU50969.1	2.25e-66	1	225	1	227
CAD0220167.1	4.50e-66	1	225	1	227
QMV68041.1	4.56e-63	1	222	1	224
QQT56222.1	6.46e-63	1	222	1	224
QQT32756.1	6.46e-63	1	222	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	7.41e-54	2	222	2	224	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]
2APJ_A	1.36e-19	5	215	25	248	X-RayStructure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_B X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_C X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_D X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L9J9	1.44e-19	5	215	25	248	Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2
D5EXZ4	9.91e-07	5	224	49	293	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000403_01160.