CAZyme Information: MGYG000000403_01240

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000000403_01240
• CAZy Family: CE14
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		25974.73	5.1202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000403	2138464	MAG	Sweden	Europe

• Gene Location: Start: 1521; End: 2225 Strand: +

Full Sequence      

MNVLAIGCHPDDMEINCAGTLAKCAARGDKVTVCHVANGNLGHEIIEPDELRNMRAKEAQ
NAGKLAGIEVVTCDIGDLMVYEGSKAQRDLVVDVIRSTQPDFIITHAPNDYMPDHVAVSR
LVFDATFAASVPHYKTAAAGKSEVTPLYYMDNLAGVNFIPTEYVDISDQIDKKLEMLECH
ESQLKWMRDHDNIDFAEFVKTCARYRGLQCGVQYAEGFTQCLAWPKLVPKRLLP

Enzyme Prediction     

No EC number prediction in MGYG000000403_01240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	4	114	1.3e-21	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2120	LmbE	1.27e-37	1	190	11	201	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	7.19e-27	5	122	1	124	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39662.1	1.09e-104	1	234	1	242
QTH40105.1	7.68e-101	1	234	1	236
BBI35200.1	5.94e-98	1	234	1	236
QNK60158.1	2.41e-97	1	234	1	236
BBH21372.1	8.53e-97	3	234	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXD_A	3.30e-20	1	218	4	217	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
6P2T_A	1.57e-19	2	218	25	239	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	6.05e-13	1	222	2	217	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81ST8	7.83e-21	1	218	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1
Q81FP2	1.56e-19	1	218	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
P42981	3.14e-19	2	218	5	219	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB1 PE=1 SV=2
Q6F4N1	1.62e-13	3	217	34	249	Diacetylchitobiose deacetylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=dac PE=1 SV=1
P71311	3.89e-06	3	182	19	185	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000403_01240.