CAZyme Information: MGYG000000403_01617

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000000403_01617
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33829.6	4.529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000403	2138464	MAG	Sweden	Europe

• Gene Location: Start: 188; End: 1123 Strand: +

Full Sequence      

MSWASSDPSVVTVDENGNLHGVSEGNAMITATASNGAEDTFTINIVPDDGNPFEFKVISE
PISERIAKLSMPVVYSQYKYTLDSAIRTQLTKSPVIFTTFSSPASESDVRNYINPANFSS
GSEKYQFALLDRTNGISETALNAYLSNKGVLSGKGSIILAAAKQNSISEIYLAVHAALES
GNGASELARGIDFNGTVVYNLFGIGAYDKDPVNEGAKYAYEQGWTDIDKAIYGGAKWISE
NYINASSKQNTLYKMRWNPANPGVHQYATDIAWAAKQSKIIYAMFSSLPYADVTFDVPVY
RGENEVPVSYE

Enzyme Prediction     

No EC number prediction in MGYG000000403_01617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	157	283	2.2e-24	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	2.15e-80	104	301	51	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
smart00047	LYZ2	2.02e-35	145	292	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.10e-07	155	233	1	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
pfam02368	Big_2	4.90e-07	3	40	36	73	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
PRK06347	PRK06347	2.79e-05	87	281	99	294	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL75914.1	8.42e-73	104	301	347	545
AHG23324.1	7.41e-71	76	301	207	435
AOZ78858.1	1.01e-67	76	301	307	535
AJA51754.1	1.01e-67	76	301	307	535
AOZ75063.1	1.01e-67	76	301	307	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FXO_A	8.03e-54	124	301	61	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
6FXP_A	3.40e-45	104	305	49	250	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50],6FXP_B Chain B, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50]
6U0O_B	1.49e-44	104	305	79	280	ChainB, LYZ2 domain-containing protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4PI7_A	5.14e-40	136	281	65	208	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
4PI8_A	3.97e-39	136	281	65	208	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39848	1.22e-52	104	301	682	880	Beta-N-acetylglucosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytD PE=1 SV=1
Q6GAG0	1.25e-48	124	301	1067	1250	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1
Q8NX96	1.25e-48	124	301	1073	1256	Bifunctional autolysin OS=Staphylococcus aureus (strain MW2) OX=196620 GN=atl PE=3 SV=1
Q99V41	1.69e-48	124	301	1065	1248	Bifunctional autolysin OS=Staphylococcus aureus (strain N315) OX=158879 GN=atl PE=1 SV=1
Q931U5	1.69e-48	124	301	1065	1248	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000046	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000403_01617.