CAZyme Information: MGYG000000404_01224

Basic Information

• Species: UBA11774 sp003507655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA11774; UBA11774 sp003507655
• CAZyme ID: MGYG000000404_01224
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000404_9|CGC3	66029.93	5.2615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000404	2228546	MAG	Sweden	Europe

• Gene Location: Start: 82058; End: 83827 Strand: -

Full Sequence      

MVKVDLTKKPYFLEKEDIQWVEDTIAEMTTEEKIGQLFVNMGSERSEGYLKDVLEKYHIG
AVRYNPGTSKEVHEQNRILQENAKIPLLIAANTEAGGNGACTDGTEIGVEVKIGATKDPK
YAHEMGRVSGIEAAALGCNWSFAPITDINRNWRNPIISSRSFGSDPDMVLEMSKAYMKGF
MESNMVCAMKHFPGDGIDERDQHLSNSVNTYSTEEWDATFGKVYSGMIDAGVHTVMAGHI
MLPSYQKYFNHQMELEDTLPATLSKELIDGLLKEKLGFNGMVVTDASHMVGMTSVMKRSK
MLPTAIAAGCDMFLFFNDPEEDFSYMMEGYRSGIITEERLEDALRRILGIKAYLGLHKKN
KKEIVPRKEGLNVIGSPEFKEIAAEVSDKAITLVKNTGTSPLPLSVKEHKRILIVPQETP
NPFAFMMGGKNKKKPVEYLKEKLEAEGFEVTIYESMMDKILKAPEEEAGKMMLNMYAGKA
PISSITDNYDLIIQLAEITNLFGVTQRINWKMSKGTPDIPWYVHEVPTIFISLASPFHLA
DVPQVKTYINCYDKNEHTLDALVEKLMGRSEFTGKDPVDSFCGMMDTRI

Enzyme Prediction     

No EC number prediction in MGYG000000404_01224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	314	2.1e-52	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.05e-66	28	415	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.79e-64	29	348	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.76e-25	120	320	97	284	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.41e-23	21	415	38	416	beta-glucosidase BglX.
PLN03080	PLN03080	1.56e-04	163	435	174	444	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10123.1	1.10e-308	4	588	2	588
ALC92197.1	3.59e-278	1	589	1	586
QFK71386.1	3.86e-278	1	589	1	588
QQJ89971.1	2.77e-275	2	589	1	586
QEH09906.1	2.26e-274	2	589	1	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	5.02e-138	6	589	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	2.58e-46	28	579	42	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.02e-46	28	579	16	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.32e-45	28	579	46	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	2.39e-44	28	577	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	5.83e-140	4	589	2	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.42e-45	28	579	42	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.04e-27	75	402	88	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	1.05e-22	86	320	58	287	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q7NWB7	1.62e-22	120	321	101	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000404_01224.