CAZyme Information: MGYG000000406_00683

Basic Information

• Species: UBA10677 sp003533505
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp003533505
• CAZyme ID: MGYG000000406_00683
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		84241.51	5.6469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000406	1936952	MAG	Sweden	Europe

• Gene Location: Start: 66124; End: 68385 Strand: +

Full Sequence      

MLLSDKFYSCTKEYNTIHHHVAAPMLRKSFTLGSVPKKAEITVTGMGFYVLFVNGKNITK
GALAPYISNPDQIIYYDNYDVAEYLTEGENVVGLLLGNGMQDEDTRVWDFYKNAFRSAPK
FAIAVEADGKLLFEADGGFKWRPSPVTFDSLRAGERYDAREEADGWNAPGFDDKTWGEPF
AVPSNKGEKRICAAPPITVYREIKPVTVFKSKANTYIYDFGENNAGTIRLKVKGERGQKL
TIKLGEIANFHGVDQANISFDDQTMPGYIQTVEYTLKGGEEEVYVPHFTYFGFRYAEVMW
LRPEQASSDLLTYLVMSSRMDDSGTFECSDYIVNRIQQNAVRSNRSNFYYFPTDCPHREK
NGWTGDAALSAQQFLMNMDVEDSLVEWLRCVCRAQREDGALPGIIPTGGWGFDWGNGPAW
DIALTMLPFMLWRINGNLDCFRECADNIYRYIEYIPSKLDDKGLAHYGLGDWCEVDGPGG
ELTTPLVVTDTLTLVNLTRMATELFAAVGDNRRSKTCSELHDRLVAAFRSRLMNADHTEV
VPLSQAGQAMAMYYGAFRKDEMQAALVGLKKAIAKYDGHIQIGVLGARTLFRVLSDMGET
ELAYRMITRPDYPSFANHVLTGATTLYEIFRKPSEEFPYTSDMFACGSHNARSLNHHFWG
DVSGWFYEALGGIRINEGLTKHTDVVIDPKTVSALDSVRATHVFKGLGTLVVEWKRTGGS
VAVTVTVPVGVHAVFKPTGEVLPCGVTTRVIEQ

Enzyme Prediction     

No EC number prediction in MGYG000000406_00683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	209	734	3.5e-117	0.9900793650793651
CBM67	19	181	8.5e-28	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.68e-76	321	670	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.27e-30	36	199	3	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.68e-21	210	315	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.21e-06	685	752	12	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	5.37e-138	21	752	141	859
QNN24933.1	9.21e-124	23	740	352	1058
QGA23306.1	2.31e-123	22	729	160	854
AHF16194.1	5.98e-123	16	728	165	852
AYB33152.1	4.89e-122	24	740	185	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.18e-97	23	729	176	890	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.85e-73	22	728	301	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.72e-63	27	689	135	794	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	1.04e-07	34	182	35	179	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	4.11e-73	22	733	183	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.33e-72	22	728	301	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	8.46e-65	26	737	173	878	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.44e-58	26	728	177	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000406_00683.