CAZyme Information: MGYG000000406_01076

Basic Information

• Species: UBA10677 sp003533505
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp003533505
• CAZyme ID: MGYG000000406_01076
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	MGYG000000406_7|CGC1	49155.38	5.3662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000406	1936952	MAG	Sweden	Europe

• Gene Location: Start: 6605; End: 7897 Strand: +

Full Sequence      

MKITFLGAGSTVFARNVLGDCLLSELKDYEIALYDIDERRLDESYVIITAMRDKYNKSVK
VDKYTDAREAFRGANYIINAIQVGGYEPCTVTDFEIPKKYGLRQTIADTLGIGGIFRALR
TIPVMKAYADIMEEVCPNVLFLNYTNPMAMLTGFMQRYTGVKTVGLCHSVQVCVPGLAKS
LDMPELNDAKWKIAGINHMAWLLELKDKDGNDLYPAMKKKFNEVRPECDRVRLDMMNHFG
YYNTESSEHTAEYHPYYIKDKYPDFIEKYNIPLDEYPRRCVRQIEGWAKERDEILNGGDV
THERSREYGSRIIEACETDVPFRIHGNVLNTGLIDNLPPEACVEVPVMVDRNGLNPCHVG
RLPEQLAALNMTNINVQLMTIRAAVTRKKEDVYMAAYLDPHTKAELSMDDIKSMCDDLFE
AHGDWLPKYN

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	179	1.6e-64	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	1	419	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	429	2	430	alpha-galactosidase; Provisional
COG1486	CelF	2.22e-177	1	429	4	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	8.12e-69	2	183	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	3.88e-65	1	426	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI61937.1	1.79e-211	2	430	3	433
QBE95675.1	2.93e-207	2	429	3	439
QJU16138.1	5.90e-207	2	429	3	439
ANU78021.1	5.90e-207	2	429	3	439
ASU30829.1	5.90e-207	2	429	3	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.24e-36	1	407	6	426	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	4.11e-31	1	429	5	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1U8X_X	5.99e-29	2	428	30	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
7BR4_A	5.75e-28	1	419	13	466	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	1.46e-27	1	419	13	467	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	9.72e-205	2	429	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	1.81e-138	2	427	6	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	2.37e-136	2	429	6	448	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	4.12e-71	2	429	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
A9KTB9	1.49e-46	1	428	11	462	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000406_01076.