CAZyme Information: MGYG000000406_01134

Basic Information

• Species: UBA10677 sp003533505
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp003533505
• CAZyme ID: MGYG000000406_01134
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000000406_7|CGC2	83121.21	4.8008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000406	1936952	MAG	Sweden	Europe

• Gene Location: Start: 82189; End: 84414 Strand: -

Full Sequence      

MWIKRKRENESEGLPVFTKSFSAREGLVKCELAITATGIFSASINGYEIPDLFMPGWCNY
LKRVDVCRYDVTRLINENNVISVTVANGWYSGKLGYGNKTNVFGDEKRLFAELTLTYADG
EVEKIVTDEDWTATTSDVVFADFFDGEVIDARLRNKEKRAKNAEISDFSVPLTEYSCEPV
RVVETLTPTVIYEDERVIRYDFGRNVAGMISLEASGEPGDKIVVKYGEMLDENGGVYTEN
LRRARCTDEFILSGGELDCFKPEFTYHGFRYAEISKPASSRVHGIEGRVISQDIEYYGSF
ECSDEVINGVYAMARNGQRSNFVSIPTDCPQRDERLGWTGDAEVFCNSAMFNADCKRFFT
NYLRLIRDDTPASGRIPSIVPLYMPIADNTAGVPGWGDCIAVMPYFHYLHYRDESVIRDN
LPTAEKWIAYYIGKSENYLTKITNNFGDWLSQGGETDANVINQIFFAYSTRLTASMCGII
GESDKKAYYSDVYEKVKRAFRACYYKNGRITSDTQTAYAFAYAAGLISRDETAKRLPDTV
HERGDALTTGFIGSRFILPALCDAGETELAYRLIKRTEYPSWGYMLAQGATTVWERWNGY
TAEHGFEDPEMNSLNHYSLGSCTEWLYSYVLGIKLSADSEKTIISPSFSREISCARGGTR
LSGGNIFVSWKYEKSAVRLTVVAADGVDYEIDKGLGSLAAIEKRGNDTVAVFATDGESDG
AFSHRDERSCDTRAAKRCICP

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	195	691	2.3e-151	0.9841269841269841
CBM67	2	155	1.3e-16	0.8295454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.63e-116	298	630	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.26e-35	32	199	8	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.29e-26	200	291	10	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF26773.1	2.91e-158	19	681	149	853
AEI42913.1	3.71e-155	2	691	80	801
AFC30614.1	6.96e-154	2	691	125	846
AFH62916.1	2.98e-152	2	691	125	846
ASA21372.1	6.15e-150	2	681	123	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.35e-128	29	680	318	981	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.93e-99	17	633	134	778	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.22e-95	15	671	177	876	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.73e-129	19	692	179	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.59e-128	29	680	318	981	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.86e-120	21	690	177	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.50e-60	17	681	187	894	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000406_01134.