CAZyme Information: MGYG000000408_00531

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae
• CAZyme ID: MGYG000000408_00531
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000000408_3|CGC2	38621.41	9.4687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000408	1810289	MAG	Sweden	Europe

• Gene Location: Start: 88624; End: 89637 Strand: -

Full Sequence      

MNDFKKILLINFGGIGDEILFLPTINTLKKVFPNSHITLALESRSKSIINLTDLIDQVFE
VNINSKNKYLELFKLILFARKNKFNMVISSGSNKFIPILLLLMNIKERYGYNNGITSHLL
TEKVNLNKNQYASYMYHDLLRPITDIKCELPKIEIKPNVKWSLQNQIYKEENSVLIHPGV
SKMSIEKNIIKIFKAPIWANIINRLLSSGKKVYLAGGPDDETIIREILSLIDTQNPLFYN
MYGKTKNIEQLAQLIKKSEVVICSDSAPMHISIAVNTKTLAIFGPTDEKKLLPPDNKNFI
AVTNNCNCRPCLWDKRMTSCKDLFCLNFDIDDIIKYI

Enzyme Prediction     

No EC number prediction in MGYG000000408_00531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	315	9.6e-35	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.35e-49	5	311	2	304	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.23e-46	6	337	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.80e-22	136	312	68	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02201	heptsyl_trn_III	1.36e-19	6	287	1	290	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.25e-15	4	293	5	298	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	2.01e-115	6	337	2	326
QDZ41392.1	6.63e-49	6	305	2	301
AFZ45897.1	1.31e-48	6	302	2	298
BAI93916.1	1.84e-48	6	297	2	294
QNH55727.1	1.84e-48	6	297	2	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.63e-12	3	287	7	291	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	4.63e-14	16	287	5	280	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P45042	1.57e-09	6	297	2	301	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	3.99e-06	6	297	2	301	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	9.46e-06	6	297	2	301	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000408_00531.