CAZyme Information: MGYG000000408_00879

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae
• CAZyme ID: MGYG000000408_00879
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000000408_5|CGC1	55398.87	8.293

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000408	1810289	MAG	Sweden	Europe

• Gene Location: Start: 34511; End: 35950 Strand: -

Full Sequence      

MSKKIELVKKNLEEVKKGLKGFTERIVLLSIICFVWVFLDLFQNRLPGFCAVFTLLILLT
LYAFYMQIAFKHKKRKEKGLPKVQEKNNYHPFVSILIPAHNEEKVIENTIKNIMELDYEN
YELIVIDDRSKDNTAKVLIELEKEYSRLNALIRAEDAFPGKSAVLNEALAFAKGEVILVF
DADARIEPDFLTRLLPDLEPKDIGAVQARKVIINRNENFLTRCQDNELALDTHFQVGRDA
VKGAVELRGNGELIKRKALEDINGWNNYTITDDLDMSTRMHIKGWDIRFNPDVCVYEEGV
LTPLALLKQRRRWIEGAIRRYLENFIPILFSKDMSLRTGLDMTAYIAQFILPFAALSEII
MQIIKHINGFQNSVLSSLILSTFICIFYMIGLSYSIRRYNKISIGKSIIQGFETSVYFIV
LWFPLVMFIVFKIIFAKKNMDWGKTTHGLTRIIENLRDSRDDIGIDMISSEKEKEKVEV

Enzyme Prediction     

No EC number prediction in MGYG000000408_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	91	314	1.6e-38	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.19e-61	49	447	17	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.67e-54	95	273	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	4.51e-46	91	316	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
PRK11204	PRK11204	5.45e-45	34	430	5	388	N-glycosyltransferase; Provisional
pfam13641	Glyco_tranf_2_3	1.26e-36	90	314	1	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38294.1	3.31e-161	66	451	1	387
BDA68096.1	6.47e-83	91	447	106	463
BAZ61295.1	2.36e-79	91	447	106	463
BAZ15148.1	2.36e-79	91	447	106	463
AFZ12267.1	3.32e-79	91	447	99	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	4.62e-13	89	297	40	246	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	4.65e-13	89	297	41	247	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	9.99e-11	161	322	214	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4P00_A	1.05e-10	161	322	227	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.05e-10	161	322	226	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	3.81e-74	91	447	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.06e-73	91	447	106	463	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
P74165	2.01e-62	90	448	107	467	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	1.08e-32	57	328	15	294	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q6L538	1.64e-26	79	332	218	481	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	38
48	70
342	364
374	396
416	435