CAZyme Information: MGYG000000408_01131

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae
• CAZyme ID: MGYG000000408_01131
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000000408_6|CGC1	40923.33	9.1183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000408	1810289	MAG	Sweden	Europe

• Gene Location: Start: 121057; End: 122130 Strand: +

Full Sequence      

MKLFRILLLLIFISMGLVSNVYSATLDEMIGQMILIGFQGKSTFSSDYKALKKQIEKGHI
TGVILFSKNISNPEQLAKLTENLKSIKSKEPIFISIDQEGGNVSRLNKKNGFDNFLSFKD
LGNLDSQKIETEYSKMIKLLKKYNFNLNFSPCVDLDTNPESIISKKNRSFSNNPYIVAEK
SKIIIDVQNKYNIISCLKHFPGHGSALGDTHLSYVDTTDTWSWDELIPYQELKDQKNIMI
MISHVYNQKLDSIYPASMSYTIVTDLLRKYIQYDGVIISDDLDMKAIKDNYNLENIIINV
INSGSDILLFSNYEQSNPKLAYEVTSIIKKAIKEKTIKKERIEESYNRILKLKREAL

Enzyme Prediction     

No EC number prediction in MGYG000000408_01131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	309	9.1e-40	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.41e-62	25	353	2	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.73e-51	25	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.69e-32	62	286	28	255	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.56e-06	146	280	152	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEI13913.1	6.86e-87	5	353	3	350
ADN36290.1	1.34e-82	24	357	53	396
QDF29347.1	5.35e-82	2	350	3	354
AHE66077.1	5.51e-82	25	353	13	361
QOG13324.1	1.29e-80	33	352	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	8.54e-38	25	353	43	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.43e-37	25	353	17	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.27e-37	25	353	47	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	5.12e-35	18	353	5	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3WO8_A	9.23e-34	26	351	12	322	Crystalstructure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8],3WO8_B Crystal structure of the beta-N-acetylglucosaminidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	1.01e-38	25	353	17	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P40406	4.68e-37	25	353	43	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q2KXM7	6.27e-28	52	312	29	294	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q0AF74	8.39e-28	54	320	22	292	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
P44955	1.68e-27	34	312	4	280	Beta-hexosaminidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000369	0.998794	0.000248	0.000188	0.000195	0.000196

TMHMM  Annotations     

start	end
7	26