CAZyme Information: MGYG000000409_01227

Basic Information

• Species: QALS01 sp003150575
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp003150575
• CAZyme ID: MGYG000000409_01227
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000000409_7|CGC1	45402.79	5.807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000409	2691378	MAG	Sweden	Europe

• Gene Location: Start: 54827; End: 56035 Strand: +

Full Sequence      

MESKIKVGVIGLGSRGSSMLKSVLLKNTEIEVAAVCDVYRDRVEETAKLVAETYGREPSK
TLDYREVTKNAAIEAVFVFTDWSTHIGIAMDAMERGKAVAMEVGCAYSVRECWDLVRTYE
RTKSPFMMLENCCFDKDELMVTNMVRRGKLGTVVYCSGAYGHDLREEIADGYKNRHYRKD
NYLHRNCENYPTHELGPIAKILDINRGNRMLSLVSFASKGVGMREYIKEKRPEEYSDGLV
YRQGDVVTTLIKCANGETIRLKLDTTLPRRYDREFTVRGTKGNFKQTLEAVFLDGEDEWA
TPEKVINNREKYAEYLPPVWKNMTEEAKQSGHGGMDGITVGEFIRALKTGGEMPVDVYDA
AAWMSISALSEESIATGCVVPVPDFTDGKWVTRKSKDVIELE

Enzyme Prediction     

No EC number prediction in MGYG000000409_01227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	392	1.3e-137	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.25e-24	4	384	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.47e-11	5	128	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	3.76e-152	1	394	1	399
QJD87109.1	7.38e-147	1	394	1	398
QTH41319.1	1.33e-146	1	394	4	401
QNK55026.1	1.97e-144	1	394	1	398
ALS29040.1	7.65e-143	1	394	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.95e-86	4	395	20	436	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.50e-67	4	402	42	450	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	3.30e-06	4	282	5	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	2.16e-85	4	395	20	436	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	4.79e-80	4	394	33	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	2.67e-78	5	394	43	436	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
A4Q8G1	1.19e-77	2	394	50	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	6.88e-76	2	394	47	461	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000409_01227.