CAZyme Information: MGYG000000409_01437

Basic Information

• Species: QALS01 sp003150575
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp003150575
• CAZyme ID: MGYG000000409_01437
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		60841.15	5.433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000409	2691378	MAG	Sweden	Europe

• Gene Location: Start: 118815; End: 120425 Strand: +

Full Sequence      

MKVIYPVKTIAYEGVKNVDALRAEQPLQIGLMEKNTAVFSGKSYVILDFSKELSAGIRIL
VHRVNGEGKVRLRFGESVTETCAELGFKGASNDHSNRDFTADLQDYSDMTFGGSGFRFLR
LDVLGENSEITVKSIVAVSDADERKEIGCFECDDERINEIWKTAAYTLRLCLHNGFFWDG
IKRDRLVWIGDLHPEMKSAFALYADVPEAKNSLVFSENETKLPDWINGIPMYSFWWLIIL
CDDYTHGGDREFVKARLPYAKSILSQIDEYIDESGETHFPVNFIDWPTHYTEEDGEEKKR
DEYAGVHYLLKIAAEKMLRLLNEFGEETAKCRRILEKLFRKSFKVGKYKQIAALGVLAGE
KTEHNREILLADGAKGFSTFMSYSILSAMAAYGEYESALSALKEYYGGMLDLGATSFWED
FDVTWKENAFRIDELPVAGKKDVHGDYGAFCYKGFRHSFCHGWASGVVAYLSEKVLGIEP
EGVGCKKFRIRPHLDGLNRVKGAYPTPYGTLYVEHHIKDGKTETMVRAPEEIEILY

Enzyme Prediction     

No EC number prediction in MGYG000000409_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	42	532	4.9e-83	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.38e-12	145	422	1	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.22e-06	477	530	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL50446.1	2.08e-140	34	535	80	579
QUT95156.1	2.07e-135	45	534	78	580
AST53793.1	2.07e-135	45	534	78	580
ABR43079.1	8.28e-135	45	534	78	580
QRO16730.1	8.28e-135	45	534	78	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.01e-35	45	530	194	687	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.37e-10	40	464	91	531	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000409_01437.