CAZyme Information: MGYG000000409_01564

Basic Information

• Species: QALS01 sp003150575
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; QALS01; QALS01 sp003150575
• CAZyme ID: MGYG000000409_01564
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase XylQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	MGYG000000409_9|CGC1	58267.56	4.9308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000409	2691378	MAG	Sweden	Europe

• Gene Location: Start: 78306; End: 79832 Strand: -

Full Sequence      

MQKIGFLTDELWYGGVVFHADKYPLSKNDCYEFDTGVNESCNQFNPIFLSNKGRFFWCGN
GGKVRFDHGTIEISNDEVKFERAGKTLKEASIAAAEKYYPATGTTPDKRAFEAPQYCSWT
VFLWKQNQEKILRYARSIVEKGYKPGIIIIDDTWQRAYGVWDFNKENFPDPHAMMKELKE
LGFTVSMWLCPYVSPDAPYLSPGIFEHMENKRVLTDGDKPKFIHWWEGYSAMLDFRQPSA
VKWINEQTKFLEEEYGAEGFKLDGGDAMYTGIDYRDASLLSSLYIDCIDNPLKEARACYK
LAGKPIIQRLNDKAHLWKNKPQDYLIGLEGVLPGMLTQGLVGYYYGCPDMIGGGMSSDFI
DTSKLDSELIIRWCEASILMPMVQFSYDVWNHEENRVAECCKKAMALREKLLPYIIELIE
NASKTNQPVVRYMEYEFAEDRFAGMKTQFMLGEAYLVAPVLDKDVTEISVEFPRGEWQDI
ADGEIYKEGRHTVAAPIDKLPVFKKVVG

Enzyme Prediction     

No EC number prediction in MGYG000000409_01564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	95	504	1.2e-73	0.955503512880562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.77e-123	112	477	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	1.27e-52	83	503	4	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	1.79e-52	46	505	195	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	9.65e-34	161	503	261	616	alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	2.10e-22	119	411	9	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQW26139.1	7.21e-133	9	506	14	511
AMN32313.1	7.21e-133	9	506	14	511
ABG83900.1	1.05e-132	9	506	4	501
QGY45215.1	1.98e-132	3	505	26	532
SQI03748.1	4.08e-132	9	506	14	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7C_A	3.48e-28	36	503	230	708	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
1XSI_A	1.18e-24	46	503	198	662	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
2F2H_A	1.18e-24	46	503	198	662	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
5AEE_A	5.84e-24	15	503	154	661	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5F7S_A	1.49e-23	168	506	367	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	1.36e-53	97	486	299	690	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	5.01e-53	97	486	298	692	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P96793	7.70e-29	29	490	178	650	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	2.70e-26	2	505	154	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P31434	6.43e-24	46	503	198	662	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000409_01564.