CAZyme Information: MGYG000000410_01433

Basic Information

• Species: Zag111 sp002102825
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp002102825
• CAZyme ID: MGYG000000410_01433
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000000410_6|CGC1	27405.81	9.6889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000410	1882952	MAG	Sweden	Europe

• Gene Location: Start: 23029; End: 23793 Strand: +

Full Sequence      

MFSEMIQNLLNSGGKAAAMQRTAQINNYVKSVNRQLNPQASTQVSSLDTIYPPNGNNNIQ
SFEKILSGTTESNFGSLLLNPKSLNVNGNIYDNSGDISADGITSSTLLNAIKEVNDSKRD
YSNKTSLYSDKSQLIGMINKVAQKHGVDEKLVQAVIKQESGFNPNATSRTGAKGLMQLMP
STAKALGVNDPYNAAQNVDGGVRYLKSMLNKYHGNVILALAAYNAGPGAVDKYSGVPPYK
ETQNYVKNILANYL

Enzyme Prediction     

No EC number prediction in MGYG000000410_01433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	150	253	1.1e-35	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	6.58e-54	149	253	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.01e-49	138	253	10	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	9.41e-45	138	253	8	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	7.52e-37	140	230	3	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	6.57e-35	138	245	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38062.1	5.19e-95	1	254	1	238
QNF30947.1	3.89e-54	137	253	31	147
AYJ89685.1	7.99e-52	129	253	129	253
AWI36246.1	7.99e-52	129	253	129	253
QNH48653.1	7.99e-52	129	253	129	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.72e-16	142	252	424	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.73e-16	142	252	428	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.74e-16	142	252	438	565	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.74e-16	142	252	434	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.75e-16	142	252	444	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.43e-49	138	253	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.29e-41	94	253	1392	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.29e-41	94	253	1392	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.44e-16	138	226	11	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	3.20e-16	137	230	289	388	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000410_01433.