CAZyme Information: MGYG000000411_01089

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister
• CAZyme ID: MGYG000000411_01089
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000000411_9|CGC1	33038.83	5.6926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000411	1335301	MAG	Sweden	Europe

• Gene Location: Start: 4558; End: 5448 Strand: -

Full Sequence      

MKKILFFLIILCTAGYWGFTEGHTGWNDSSLKNLVKTEQASEPLRLGKDFLGELTDWAGA
FITGLAGSSDKDTPASPENNPKANEKPALSLMEKMNNIVHFQQALEARIERKNFVPSSEI
PDILKKAIVATEDRRFYEHGALDPIGVVRAFITNYMAGRTVEGGSTLAQQTVKNIFLSNE
RTFLRKAEELALAMQLEKYYTKDQILEMYLNTIYFGHGAYGLKEASHIYFGKEPKDLDLS
QCAMLAGLPQAPSAYDPIDHPKEGAERMTIVLTLMAQQGYISSDEATKAAMELWLK

Enzyme Prediction     

No EC number prediction in MGYG000000411_01089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	110	275	6.7e-67	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.12e-89	110	276	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.22e-86	111	294	1	184	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.22e-84	108	289	72	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.26e-74	110	289	65	244	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.55e-54	118	292	72	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25656.1	5.94e-118	3	296	2	304
AOH38594.1	9.34e-87	90	296	64	270
AXB81629.1	2.45e-68	60	292	12	252
AXL21687.1	3.79e-67	61	289	25	253
ARF99932.1	1.14e-65	89	289	54	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	6.74e-55	109	289	17	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.69e-54	109	289	17	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	7.22e-41	110	292	38	220	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5FGZ_A	2.66e-40	110	284	154	332	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.87e-40	110	284	175	353	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.11e-54	110	289	65	244	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	1.48e-49	109	289	60	240	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P39793	3.10e-49	102	289	85	273	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q07259	2.61e-47	104	292	39	226	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87626	1.80e-45	110	292	66	248	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009389	0.984582	0.005155	0.000276	0.000270	0.000285

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000411_01089.