CAZyme Information: MGYG000000412_00118

Basic Information

• Species: Succinivibrio sp000431835
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp000431835
• CAZyme ID: MGYG000000412_00118
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
701	MGYG000000412_1|CGC1	79892.44	8.3687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000412	2387553	MAG	Sweden	Europe

• Gene Location: Start: 138005; End: 140110 Strand: +

Full Sequence      

MKHPYLTFFFLIAIALPVLVLVIVAPMSAHNQFIFGLSMIGACLIAHFCSKKHFVSFCIM
MVAVVCSTRYMFFRITQTLVFPSWIDMIFGILLLIAEIYVYMVLLLSFFQLSWSLKRKIV
PLPKDTSLWPTVDVYIPTYNESLEVVRDTVLAAQCLEYPKDKIKVYLLDDGKRKEFAAFA
TEANVGYITRQKNDHAKAGNLNHAMTLTNGELIAIFDCDHITTKIFLQSTVGAFLQDEKL
ALMQTPHHFYSPDPIQRNLYLGRDIPPENDLFYGPIQRGNDNWNATFFCGSCAVIRRKAL
DEIGGFAVETVTEDAHTALRLQRRGWKTAFLDHILAGGLATEKLVQHLQQRNRWARGMIQ
IFRLDNPLLGKGLSFAQRLCYLSATTYFFFAVPCIIFMVTPLLYLIFGISIVHGSVGLLL
SYALPHLVLSIFSNSRLYGNYRYSFWGQIYDTILSFHLVLPTLVTLFLPHHGSFNVTDKG
QTVEKAFFDATSVRPHLITLGLLIFAVIFSIVKLSIPSYFDLQLGPTLLNIFWACVNSIL
LLAAICVGRETANKRKMQRLYLETPVNVYQASGICSRTIMRDLSMGGCRVDNFVTGELNI
DDDPITDIEIATDYTTMCVPVKRIHRDNENEDYLRFSFINVDLDTRREFVRLLFSRADTW
VRPDYKKDNPIRSFITILACIKDSLFSKRRSDDIHVSVVGK

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	133	304	1.1e-36	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	9	691	11	708	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	2	679	130	804	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	9.93e-116	130	362	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.32e-52	71	520	1	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	2.23e-31	134	363	2	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG07429.1	7.59e-276	8	683	6	674
AYN28329.1	1.53e-275	8	692	6	686
QNQ18465.1	2.09e-275	14	691	12	683
ABP62595.1	1.37e-274	9	683	6	674
AZI85711.1	1.47e-274	14	691	12	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.02e-176	26	678	170	816	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.80e-106	4	590	3	605	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.04e-105	4	590	15	617	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.07e-105	4	590	16	618	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19449	1.30e-190	67	689	86	713	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
Q9WX61	8.83e-189	67	689	86	704	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
O82859	3.17e-186	67	689	86	715	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
Q76KJ8	1.01e-185	67	694	86	707	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
P0CW87	1.01e-185	67	694	86	707	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
32	49
54	72
87	109
385	407
411	433
497	519
529	548