CAZyme Information: MGYG000000412_00341

Basic Information

• Species: Succinivibrio sp000431835
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp000431835
• CAZyme ID: MGYG000000412_00341
• CAZy Family: GT2
• CAZyme Description: Validoxylamine A glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000412_1|CGC3	31147.91	9.4816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000412	2387553	MAG	Sweden	Europe

• Gene Location: Start: 410913; End: 411719 Strand: -

Full Sequence      

MLISVIISTYNRPDALKLILSAFDMQSDREFEVIVADDGSKDDTRKVVQQKMIDCSYPIT
HVYQKDEGFRLARIRNLAATKAKGDYLIFLDGDCVPRPSFIACHRRLAQKNFLVAGNRIL
LKEEFTKFVLAKQDPIYAYSFFKWVSVYLKHGINRLHPLIVFPYFQHLRNLKQKWKKARG
CNFALFKDDYFKVDGCDSDFKGWGYEDSDLAIRLIHAGILIKSGRYATGVFHLYHHENDR
SREKENLEKLNERLNSDIVKAENGISKL

Enzyme Prediction     

No EC number prediction in MGYG000000412_00341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	133	7.4e-25	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06420	GT2_Chondriotin_Pol_N	3.33e-81	5	234	1	182	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
pfam00535	Glycos_transf_2	7.95e-22	4	143	1	140	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.24e-21	5	111	1	105	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.77e-16	1	235	3	230	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam02709	Glyco_transf_7C	1.33e-15	175	236	16	77	N-terminal domain of galactosyltransferase. This is the N-terminal domain of a family of galactosyltransferases from a wide range of Metazoa with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases. EC:2.4.1.90, N-acetyllactosamine synthase; EC:2.4.1.38, Beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase; and EC:2.4.1.22 Lactose synthase. Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin, in the absence of alpha-lactalbumin EC:2.4.1.90 is the catalyzed reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEG02405.1	1.09e-79	2	267	4	270
AXS78707.1	1.09e-79	1	265	1	266
QSB00962.1	4.18e-77	2	267	4	270
AMK77349.1	1.85e-76	2	267	4	270
AXK83771.1	4.93e-76	2	268	4	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H2K893	1.98e-14	2	230	10	240	Validoxylamine A glucosyltransferase OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) OX=1133850 GN=valG PE=1 SV=1
Q15JF5	2.14e-14	2	230	41	271	Validoxylamine A glucosyltransferase OS=Streptomyces hygroscopicus subsp. limoneus OX=264445 GN=vldK PE=3 SV=1
Q9CMP0	2.20e-14	3	222	153	378	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	1.44e-12	3	260	160	418	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
O06483	3.66e-10	4	241	4	262	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000412_00341.