CAZyme Information: MGYG000000413_01540

Basic Information

• Lineage: Bacteria; Firmicutes_B; Peptococcia; Peptococcales; Peptococcaceae; UBA7185
• CAZyme ID: MGYG000000413_01540
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278		31344.5	4.9759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000413	2856126	MAG	Sweden	Europe

• Gene Location: Start: 7075; End: 7911 Strand: -

Full Sequence      

MKRFREEQLLPVALACGVLLMMGWFTLTSAQQHGQAPVGSDFTEASVPVLMYHHLLPQED
LTGLFADNNVAVSVEQFRQDLTTLKEQGYQTISLRQLSAFVQDGAELPGKCVLITFDDGY
LSNKIYAQPILEELGYTAVIFALTGWIEEHPQTFHPKGLQYLSWPEIGEMKSTFQFASHT
DNLHDLSWNGKGKLTTVSDAELTADLNRSIKKLQGTQYFSYPYGHYTDSARKILAQQGID
LAFTVEPVNVRAGDDPLTLGRWDMYQYSIEDVLAQRRK

Enzyme Prediction     

No EC number prediction in MGYG000000413_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	105	242	1.2e-23	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10966	CE4_yadE_5s	8.15e-58	108	271	1	163	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
cd10969	CE4_Ecf1_like_5s	2.56e-43	75	261	2	199	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	5.03e-42	112	261	2	151	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10965	CE4_IcaB_5s	9.26e-29	108	274	1	169	Putative catalytic polysaccharide deacetylase domain of bacterial intercellular adhesion protein IcaB and similar proteins. The family is represented by the surface-attached protein intercellular adhesion protein IcaB (Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase, EC 3.5.1.-), encoded by Staphylococcus epidermidis icaB gene from the icaABC gene cluster that is involved in the synthesis of polysaccharide intercellular adhesin (PIA), which is located mainly on the cell surface. IcaB is a secreted, cell wall-associated protein that plays a crucial role in exopolysaccharide modification in bacterial biofilm formation. It catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. IcaB shows high homology to the N-terminal NodB homology domain of Escherichia coli PgaB. At this point, they are classified in the same family.
TIGR03938	deacetyl_PgaB	9.51e-28	71	261	23	245	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU29695.1	3.06e-35	46	271	71	303
BAD41335.1	8.78e-31	49	275	1	223
AEE91926.1	2.97e-28	46	261	46	261
CCP26752.1	2.97e-28	46	261	46	261
AKQ03229.1	1.32e-26	46	259	55	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	6.52e-22	29	256	19	241	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
3VUS_A	5.46e-13	70	246	26	234	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	1.60e-12	70	246	30	238	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	2.90e-12	71	246	31	238	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]
5BU6_A	5.19e-12	49	276	15	274	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31666	4.55e-40	49	261	172	387	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q6G606	1.02e-19	12	246	7	253	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	1.02e-19	12	246	7	253	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	1.02e-19	12	246	7	253	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q99QX2	1.02e-19	12	246	7	253	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.394931	0.510630	0.091400	0.000722	0.000529	0.001778

TMHMM  Annotations     

start	end
9	28