CAZyme Information: MGYG000000414_00393

Basic Information

• Species: Alistipes sp900546065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900546065
• CAZyme ID: MGYG000000414_00393
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000414_1|CGC8	43522.99	4.7769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000414	2648727	MAG	Sweden	Europe

• Gene Location: Start: 472924; End: 474075 Strand: -

Full Sequence      

MKKILLSLIIIGSLGLSGCGRRHALKQELKNALAVAVEQEKAQAVRMEGIEGKLPRTFEN
GEVKVDSPYNWVSGFFPGSLWLLYEYTGDEQLRTYADEFTRRLEVLKDYKGTHDLGFMIF
CSYGNAYRLTGDPYYKSVIEQAAESLASRFNETVGCIRSWNTGRKENPELDFMVIIDNMM
NLEMLEWCGGKYADIARRHADTTIKNHFRDDYSSYHVVAYNELTGEVTDRRTAQGRSDDS
AWSRGQSWGLYGYTMMYRMTQDKKYLDQAVNIADYLIARLPEDAIPNWDYDAKEQSKDSS
AGAIMASALIELYGFTQDESYLETAERQLHSLCSDAYLAPVGENGNFVLMHGVGHYMAGS
EVDVPLTYGDYYFIEAAMRYLAL

Enzyme Prediction     

No EC number prediction in MGYG000000414_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	68	380	6.7e-121	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.02e-16	61	381	19	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04792	LanM-like	1.72e-06	191	339	514	626	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04791	LanC_SerThrkinase	6.16e-06	256	342	98	185	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	9.22e-05	21	327	153	495	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	1.90e-04	257	327	605	678	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA07645.1	1.68e-124	23	379	25	394
AHW58625.1	2.62e-124	29	379	31	394
AWI08490.1	4.10e-124	51	382	57	397
QNL52638.1	2.46e-123	3	380	2	394
ACU64224.1	3.27e-123	17	380	19	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	9.61e-109	52	380	53	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.77e-49	49	380	47	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.83e-49	49	380	48	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	3.96e-49	49	380	48	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.52e-48	49	380	48	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	9.17e-89	70	379	76	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	2.32e-52	55	380	52	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	3.70e-51	55	380	55	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.55e-48	49	380	48	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	4.07e-46	70	379	41	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000414_00393.