CAZyme Information: MGYG000000414_01211

Basic Information

• Species: Alistipes sp900546065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900546065
• CAZyme ID: MGYG000000414_01211
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	MGYG000000414_6|CGC1	94187.71	6.4654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000414	2648727	MAG	Sweden	Europe

• Gene Location: Start: 35160; End: 37715 Strand: +

Full Sequence      

MKQLFIQFLRALLPVLAAAGVSPAARAQQPSFADGYHGGIYGHYPLWCTGFFADELAKHP
EWRINLEIEPETWDSVRLHTPGDYARLRAAAAAATRRVEFVNPAYGQPYCFNIHGESIVR
HFEYGMAKLREHFPDAVVQCYSSEEPCFTDCLPALLRGFGFRYAVLKCPDTCWGGYVRGH
GRGVVSWVGPSGDTITALPRYGCEDFAEGSTWQTTAWNNSEEYIDACRRDGVRFPAGMCF
QDAGWRNGPWIGTGAATAGGSRYVTWSEYFEHVWDGRTDGAWHLTQEDIEVNLMWGSQVL
QRVAQRVRAAENRAVQAEKADLLRWLGGGESTDSLRMASLWRPLMLAQHHDCWIVPYNVV
SEGRTWAEKVDEWCGLTDSLCLDLLGRAASTTEFDVVNTSARPRRGVVRVDIPCDVAAAG
QKNIRLVDSRGDDVPCTLVNGDGGPVLVFEASTPAFGVARYRLEAGRQRCTEPSCAAYGS
AEGFVVESDIYRMVIDTLHGGAVVSLVDKLSGREIVDRSSRWGFNTLRGYFYDEGRFASS
EEQAAHVEIEELTPLTVRVAVTGAVAGEPFRQSVTLRRGDRVIDCTLRISWRGNRGIGEY
ADSGSATENRRAFKNDRYKLLLMFPSVRGRQTLRKNVPYGICRSRLDDTFFETWDAHKHN
IILDWVDVTGDDGSGLTLMSDHTTSYAHGDGVPLSLTVQYSGKGLWGRDYPLEGATEIRY
ALLPHDGGWNAAEVWNACREHAEPLYVRAAETYAGAGHSYVEVGGGCSLSSARRRGGDVE
LRLFNPSDAEAESRVSLGFGVAGVQSTRLDGTPLESIPTTRRRGRTVLTVRVPPTGFVTL
RLTPQPGRVTR

Enzyme Prediction     

No EC number prediction in MGYG000000414_01211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	54	198	1.4e-21	0.516728624535316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0383	AMS1	1.58e-05	531	843	645	942	Alpha-mannosidase [Carbohydrate transport and metabolism].
cd10815	GH38N_AMII_EcMngB_like	2.43e-05	100	203	78	178	N-terminal catalytic domain of Escherichia coli alpha-mannosidase MngB and its bacterial homologs; glycoside hydrolase family 38 (GH38). The bacterial subfamily is represented by Escherichia coli alpha-mannosidase MngB, which is encoded by the mngB gene (previously called ybgG). MngB exhibits alpha-mannosidase activity that converts 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. A divalent metal ion is required for its activity.
cd10789	GH38N_AMII_ER_cytosolic	0.004	107	163	84	140	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
smart00872	Alpha-mann_mid	0.006	308	352	17	62	Alpha mannosidase, middle domain. Members of this entry belong to the glycosyl hydrolase family 38, This domain, which is found in the central region adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase.
pfam01074	Glyco_hydro_38	0.006	99	163	76	140	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11622.1	1.62e-264	13	843	42	882
BBL08830.1	1.62e-264	13	843	42	882
BBL06663.1	1.67e-263	22	843	49	879
BBL00893.1	1.15e-261	13	843	43	881
QQA07855.1	2.91e-248	15	842	8	846

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001684	0.996654	0.000481	0.000444	0.000375	0.000332

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000414_01211.