CAZyme Information: MGYG000000415_00085

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_00085
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000415_1|CGC2	47061.94	8.6062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 83096; End: 84325 Strand: +

Full Sequence      

MKKTFKILLFTALAFGCCGSIDAKKKQKFDVNPDLPMSIRMAQSEIIRNPEGWMLDFSQK
LKWNYCHGLECQSFLDVYDHYKGNKKYAKIVAPFYTYVKDYADTIINENGIIYGYKKTNY
NLDHVNSGKILFRLYDREKDPRYKIAMDTLRAQLASQPRTSEGGFWHKKVYPFQMWLDGL
YMGEPYYAEYTATFDSNNTRAYADIVNQFLLVAKRTYDKETGLYRHAWDEIKALPWSDKS
GRAPHVWGRALGWYMMAIVDALEYLPENQPGRDKMITTLQNIVKNLAKYQDPQTGAWSQV
IDQTGREGNYLEMSCTPMYAYAIAKGVRKGYLDPSTLEMAKKAYQGILDNFIKVDEKGLV
SLTNVCGVAGLGGKPYRDGSFDYYVNEIVRDNDPKGVAPFIMLCLEMNN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	407	1.7e-118	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.71e-114	40	407	4	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.68e-101	63	407	34	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77882.1	1.94e-156	1	406	1	392
QQT77714.1	3.18e-155	1	406	1	393
QUU07653.1	3.18e-155	1	406	1	393
ASM65740.1	3.18e-155	1	406	1	393
QRP57042.1	3.18e-155	1	406	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.49e-104	63	406	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.40e-80	62	407	38	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.98e-80	62	407	28	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.64e-19	159	384	183	389	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	3.57e-18	134	406	103	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.31e-79	62	407	38	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.09e-38	182	406	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.09e-38	182	406	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	2.78e-08	176	347	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.271593	0.727639	0.000128	0.000149	0.000116

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_00085.