CAZyme Information: MGYG000000415_00484

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_00484
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000000415_2|CGC1	43340.89	6.3373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 24957; End: 26114 Strand: +

Full Sequence      

MKNTSTLLHSVCMAMALSFLLSCSSEKHREGIVLEEFLYEQADFPSCHSVTIVELENGDL
LATYFGGTHERHPDVEIRLQRKTPGGQWSAPQSVATGIQNDTLRYPTWNPVIFQPDGGEL
MLYYKVGPSPKEWWGEYIMSTDNGYTWSSPQRLELPLLGPIKNKPIQLADGTLISGSSDE
RHGWRAHIERSTDKGHTWEFIGPLNDGKKVAAIQPTFLQHGGDTIQVLCRTNGKNGNNRI
VQAWSYDAGKSWSEMTETTLPNNNSGIDAVTLRDGRHLLIYNHSTRDQENMGHKGRGVIN
LAMSRDGINWEAALVLDYIDQPGKQYSYPSMIQTSDGLVHIVYTWHRQRIKHVVVDPQKI
ETYPIIDGVWPTDKIPFVMSPVDAL

Enzyme Prediction     

No EC number prediction in MGYG000000415_00484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	40	343	1.7e-34	0.9093567251461988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	2.20e-108	58	341	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.16e-57	37	356	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	8.82e-28	47	357	33	373	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10043	Reelin_repeat_7_subrepeat_1	0.002	165	272	10	124	N-terminal subrepeat of tandem repeat unit 7 of reelin and related proteins. Reelin is an extracellular glycoprotein involved in neuronal development, specifically in the brain cortex. It contains 8 tandemly repeated units, each of which is composed of two highly similar subrepeats and a central EGF domain. This model characterizes the N-terminal subrepeat, which directly contacts the C-terminal subrepeat and the EGF domain in a compact arrangement. Consecutive reelin repeat units are packed together to form an overall rod-like molecular structure. Reelin repeats 5 and 6 are reported to interact with neuronal receptors, the apolipoprotein E receptor 2 (ApoER2) and the very-low-density lipoprotein receptor (VLDLR), triggering a signaling cascade upon binding and subsequent tyrosine phosphorylation of the cytoplasmic disabled-1 (Dab1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ01768.1	2.43e-181	28	380	12	363
ACU04978.1	1.76e-138	21	374	21	364
QEG35750.1	3.97e-135	1	371	1	362
QDT48639.1	1.03e-130	2	371	6	359
AGA77930.1	2.78e-130	16	376	13	367

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_00484.