CAZyme Information: MGYG000000415_00585

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_00585
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1173	MGYG000000415_2|CGC3	126133.8	4.5217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 156243; End: 159764 Strand: -

Full Sequence      

MALCIAMSVSSTIQSQQLAFPGAEGFGKYATGGRNGHVYHVTNLNDSGTGSFRDAVSQSN
RIVVFDVAGVIKINSRIVVKNNIYIAGQTAPGEGITIYGDGLSFSGASNTICRYLRVRMG
KVGTEGADAIGIANGSNMIFDHVSVAWGRDETFSISGSNPENITIQNCIIGQGLMGHSAG
GLVQTENVSIYRTLYIHNDTRNPKFKGRHQYVNNIVYNWKTAAYIMGGDSEGTSYANAVG
NLFITGPSGKSNAFSGANERYNIYADNNLLDSNQDGILNPVLIAQNAYEGGPTFQTVPYD
YPVLPTINAEDLFDSVVETVGASLPYRDNLDWLLIRDLKSLGVKGEIISNEADLEIGAPT
SWSLWQGTIDGEDRKDRDGDGMPDWWEIQNGTDPDSDDAMVLRDGYANIEHYINSITAEQ
SQYFLKAPSALQAEERKSTELSLSWLDFTDFEDGYIIEQKIDGSYKEIYRTPENTSSYVV
SGLDPETTYSFRVKAFNEKGESDYSNVLEVKTKSLPINVIDPETYTPDFIWSGIVSNVWD
TSTPNWDKGTFVNGKNVLFDASGAGGMISLANGLIAGNVFVKGDSDYTFSGVLSGDGSLN
KTGKGILVLDDNNTYTGGTVVWDGTLQIGKLSNGGLPSSIGTAQNWVWNGGKIKYTGNSV
STNREVALENTTEFEVSNNSTTVTFTGAISGEGDFVKSGKGVVTSAFDLHAYTGNTIVKE
GTYELKGKDLLGTEPGLHGKLILEGGTFRTTGGDGNTPGYIKFDVEVRGEETSHFHIGQR
NNIKSKFSGDGNIQLDIEYVREMYQGDWSEFYGTVTANQKGTNGNQFQLDNAKYGGIPNG
RLVLTGNLEMRGTNGGNFYIGGMSGEASTTMACCQIKTDGGTVTWIVGGLDTDETFNGKI
TNGIDHNSRIGYTSIEKEGDGIWRLNGTNKYRGTTTVNGGTLIINGAHNKDKDYTNTYYT
PGTYTVNNGGILAGNGSTTAPLVVNNGGTVSPGDMGLGTLTVKNDVTLCAGSFLRIEINK
NSKSCDRLSTTGKISISGDLEIMLTDGEYAAGDNMSIISASSYTGSFRNIVPQFPAPGLV
WDTSDLYTDGRLKIVAESDALHNPDVLALKVTVDRESICIDGLVQGVMVQVYNSSGIQIN
NGMASGSTYIIPVNNAGIYFVRVGSRVEKIYVP

Enzyme Prediction     

No EC number prediction in MGYG000000415_00585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	68	243	1.5e-53	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00063	FN3	8.13e-15	427	512	3	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	8.57e-12	427	502	3	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam00041	fn3	1.12e-10	427	505	2	85	Fibronectin type III domain.
PRK15319	PRK15319	5.14e-09	560	1040	892	1350	fibronectin-binding autotransporter adhesin ShdA.
PRK15319	PRK15319	8.45e-09	541	980	701	1073	fibronectin-binding autotransporter adhesin ShdA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV97716.1	2.74e-306	3	1081	15	1105
AGA79623.1	1.72e-128	3	528	21	544
AGA79617.1	1.98e-128	5	421	9	420
AWW32936.1	2.91e-127	5	424	9	423
QDH80548.1	4.08e-127	5	421	9	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U3H_A	4.72e-07	428	507	17	96	Crystalstructure of FN3con [synthetic construct]
4M4P_A	6.49e-06	415	520	406	515	Crystalstructure of EPHA4 ectodomain [Homo sapiens],4M4R_A Epha4 ectodomain complex with ephrin a5 [Homo sapiens],4M4R_C Epha4 ectodomain complex with ephrin a5 [Homo sapiens],4M4R_E Epha4 ectodomain complex with ephrin a5 [Homo sapiens],4M4R_G Epha4 ectodomain complex with ephrin a5 [Homo sapiens]
4BK4_A	6.85e-06	415	520	443	552	crystalstructure of the human EphA4 ectodomain [Homo sapiens],4BK4_B crystal structure of the human EphA4 ectodomain [Homo sapiens],4BK5_A crystal structure of the human EphA4 ectodomain in complex with human ephrin A5 (amine-methylated sample) [Homo sapiens],4BKA_A crystal structure of the human EphA4 ectodomain in complex with human ephrin A5 [Homo sapiens]
4BKF_A	6.85e-06	415	520	443	552	crystalstructure of the human EphA4 ectodomain in complex with human ephrinB3 [Homo sapiens],4BKF_B crystal structure of the human EphA4 ectodomain in complex with human ephrinB3 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1DPF0	5.52e-117	3	416	7	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	4.08e-116	3	416	7	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	4.08e-116	3	416	7	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
Q0CLG7	1.10e-114	15	416	18	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B8NQQ7	1.16e-112	15	416	18	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.416302	0.582737	0.000308	0.000263	0.000192	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_00585.