CAZyme Information: MGYG000000415_01410

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_01410
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000415_5|CGC4	44470.2	4.6917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 193740; End: 194894 Strand: +

Full Sequence      

MKKLSVLFLGMVLLAGCGETSSTRKPEKEDVLKSLRLANDYFMEKWSDPGEAIPYPSRKR
NYETNVWTRAYYYEGLIDLWEIDPQQRYLDYALEWGNKHDWKLRGTKNGWKTRNADNQCA
GQAYLYLYQLDPEKPERYIANIKTSVDSMMVTDKIDDWHWIDAVQMAMPIFAQLGNITGD
TAYYERAYEMYNYTKTRHGANGLYNPEDQLWWRDGDFDPPYKEPNGKDCYWSRGNGWIVV
AMVRMLELLPEDEPHRAEYAKMLVDMCGALKEVQREDGFWNVSLHDPDNYGGKELTGTAM
FIYGMAYGVNNGLLDAAEYEPVIYKAWNAMVKDCLHPNGFLGYVQGSGKEPKEAQPVTYD
REPDFDDFGLGAFLMAGTEIYKMK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	382	3.9e-85	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.89e-85	38	384	5	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.80e-45	67	379	36	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63334.1	6.33e-245	1	383	1	388
QIL77680.1	1.38e-184	13	384	18	382
QNH63514.1	1.34e-182	5	384	4	374
AUD05795.1	4.41e-182	9	384	10	377
ALW85266.1	8.12e-180	12	384	13	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.00e-62	1	379	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.35e-58	55	379	27	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.47e-52	67	384	53	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.61e-21	51	380	31	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.93e-20	51	380	21	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	7.65e-53	1	384	1	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.11e-52	67	384	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.82e-38	53	380	78	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.52e-20	51	380	31	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_01410.