CAZyme Information: MGYG000000415_01571

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_01571
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172		19488.96	9.9308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 161188; End: 161706 Strand: -

Full Sequence      

MRMIVAAICLILTCNGIVAHPRGGGVSPPSTIQIPDTLFEKAVACIKRFEGWHGNHLPYV
GWGHKLLPGETFAPDMSKAQADSLLRADLRKLCRMCSRFGKDSLLIATLSYNVGYYRLVG
YGKMPKSRLIQKLEAGDRDIYNEYVSFRCYKGKVVPSIERRRKVEYMLLFEK

Enzyme Prediction     

No EC number prediction in MGYG000000415_01571.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	1.40e-11	46	170	5	135	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.31e-10	37	172	6	149	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	7.50e-05	42	168	8	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR16310.1	1.15e-115	1	172	1	172
QUT63230.1	1.64e-115	1	172	1	172
ANU58767.2	1.68e-111	9	172	2	165
QUT82153.1	4.09e-100	1	170	1	170
QJR76753.1	2.53e-86	23	172	18	167

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999233	0.000142	0.000147	0.000130	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_01571.