CAZyme Information: MGYG000000415_02148

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_02148
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	MGYG000000415_12|CGC1	81933.42	6.7353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 39357; End: 41570 Strand: +

Full Sequence      

MKKKLFFFSLSLFSAVAMAQISQPLYLDESQPIEVRVQDALSRMTLEEKVKLCTAQSKFS
SHGVPRLGIPELWMSDGPHGVREEILWDSWGVAGFTNDSCTAFPALTCLAATWNPEMSAL
YGKSIGEEARYRRKDVLLAPGCNIYRTPFNGRNFEYLGEDPYLASVMVVPYVQELQKNGV
AACVKHFALNNQEKWRGHIDVDLSDRALYEIYLPAFKAAVQKGGAWSIMGAYNKIRGTHA
CHNDFLLNGILKGEWQFDGCVITDWGGAHDTREAVFNGLDIEMGTYTDGVAKNRDFAYDN
YYLAKEYLKGLKDGTYPVSTVDEKAARILRLIFRTAMNRNRPWGSFTSEAHYDAARRIGE
EGIVLLKNEPVKSQKSSLLPIDASKYEKILVVGDNATRYLSGGVGATTLKVKQDILPLET
LQEMYGDKITYTQGYAAGKPRYGKVDKPKVNTDSLYRKALELAEDADLILFIGGLNKNYQ
QDCEAGDRVEYNLPFGQDKLIPELAKINPNMVLVLISGNAVEMKWVKEVPAIVQAWYLGS
EAGPALANVLSGKVNPSGKLPFSFPVKLTDNGAHAFDALCYPGDSIHEVYKEDIFVGYRW
HDTKKIPPLFSFGHGLSYTTFSYGKAELSSKSMTADGTIVVNVPVKNTGDVVGKEVVQLY
VGDSKSSLPRPLKELKAFEKIALAPGEEKTVTFTITPDDLKYFDDTRHEWVSEPGKFTVY
VGSSSTDIHSKATFTLK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	283	4.4e-66	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.36e-105	15	736	8	764	beta-glucosidase BglX.
PLN03080	PLN03080	1.57e-65	26	697	42	744	Probable beta-xylosidase; Provisional
COG1472	BglX	1.25e-64	65	413	56	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.97e-53	363	618	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	2.06e-34	655	725	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK86688.1	0.0	8	737	5	737
ALJ60581.1	0.0	1	737	1	737
QUT88425.1	0.0	1	737	1	737
QUT37089.1	0.0	8	737	5	737
AGU13700.1	0.0	8	737	5	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.30e-156	35	728	3	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.82e-121	36	736	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.27e-120	36	736	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.01e-118	40	736	8	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.19e-107	36	733	53	825	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	0.0	15	734	24	743	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.81e-155	35	728	3	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	3.97e-132	37	736	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
F6C6C1	3.44e-122	44	737	12	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	7.84e-120	44	728	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.999011	0.000187	0.000177	0.000165	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_02148.