CAZyme Information: MGYG000000415_02163

Basic Information

• Species: UBA11471 sp900547555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900547555
• CAZyme ID: MGYG000000415_02163
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000000415_13|CGC1	42527.16	8.902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000415	2630685	MAG	Sweden	Europe

• Gene Location: Start: 19401; End: 20531 Strand: -

Full Sequence      

MKYYLIAGEASGDLHAANLMRAIRECDPQAEFRFWGGDAMQQVGGTLVRHYREMAYMGFV
QVALHLRQVLKNITLCKSDLAAYRPDALILVDYPGFNLKIARYAKEQLHLPVHYYISPKI
WAWKEYRIKEIKRYVDRMYSILPFEVDFYRKHGYAIDYVGNPTVDELYGRADADETFDRF
TAENRLSDKPIIALLPGSRLAEIKDNLNIMIGAASSFPDYQIVIAGAPGVPPRFYEPYLR
QGKVSIVFGKTYRLLQQSRAALVTSGTATLETALLRVPQVVGYFMRGGQFTYSLFRPFIK
VDYISLVNLIADAPVVKELLVHHFSVENARWALEPLLGETPERAAMLSGYDEVAVRLGSP
GAPQRAARLIVESLSA

Enzyme Prediction     

No EC number prediction in MGYG000000415_02163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2.6e-110	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.80e-106	1	374	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.78e-101	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.75e-76	4	320	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.06e-69	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.40e-50	1	328	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12800.1	8.67e-177	1	374	1	373
BCI64292.1	3.98e-174	1	375	1	375
QRO23865.1	1.66e-158	1	375	1	375
BBK92630.1	5.76e-154	1	374	1	375
QUR47916.1	5.76e-154	1	374	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.87e-43	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.87e-43	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.05e-64	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.62e-63	5	367	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B4UHR6	1.50e-60	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	1.50e-60	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	1.50e-60	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000415_02163.