CAZyme Information: MGYG000000417_01899

Basic Information

• Species: Acetatifactor sp900755865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900755865
• CAZyme ID: MGYG000000417_01899
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000417_29|CGC2	39483.02	4.819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000417	2910146	MAG	Sweden	Europe

• Gene Location: Start: 26934; End: 27986 Strand: -

Full Sequence      

MLKLEYDKKQIEEVIDKIVKKTMNMDLTWDWPCGVAYYGISDAYEKTGKEEYLTLLKDRV
DELIDLGLPKVWTVNACAMGHCLITLYNATKDKKYYDILMSKVEYLTKDALRFGDHVLQH
TVSANNDFPEQAWCDTLFMAAFLLLRVGVMNHDEAMIDDALNQYYWHIKYLQNPSSGFYY
HGYDNIAGDHMSGIYWGRANAWAAFTMAQVGGILPECYLYPKYIDIAGSLNEQLAALKTV
QTENGLWRTVLDDPDSYEEISASAGIAAAMLTRGNPLHSKYINKSIRGLLENVSEDGKVM
NVSGGTAVMRDKEGYRGIPRAYIQGWGQGLALSFFATLLVSDEIEKDGAL

Enzyme Prediction     

No EC number prediction in MGYG000000417_01899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	335	1.5e-77	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.25e-85	1	346	6	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.86e-68	14	336	1	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM03703.1	3.09e-245	1	350	1	350
AOZ97580.1	2.51e-191	1	350	1	349
ADL32982.1	1.02e-190	1	350	1	349
QEI31009.1	1.08e-185	1	350	1	349
QHB23517.1	1.08e-185	1	350	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.62e-35	29	332	47	362	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	9.71e-35	29	319	65	358	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.73e-33	29	319	66	359	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4CE7_A	1.41e-11	30	299	52	333	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.57e-115	1	339	1	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	7.95e-11	30	299	59	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000417_01899.