CAZyme Information: MGYG000000418_00022

Basic Information

• Species: UBA1820 sp003150615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820; UBA1820 sp003150615
• CAZyme ID: MGYG000000418_00022
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	MGYG000000418_1|CGC1	66543.02	7.4817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000418	2050770	MAG	Sweden	Europe

• Gene Location: Start: 18993; End: 20801 Strand: +

Full Sequence      

MSRFFTFILLTVLCSAACAQQTDRRTRQYLPPTRIVWMQDSSYIRGANNLLIPGNGQADL
SNRNMCVMKSTGGSHPAILLDFGRELHGGLRIVTGMPRGQKPVNVRIRFGESVSEAMSNA
GENGATNDHAMRDFKMSLPWLGVAETGLSGFRFARIDLLDDDSELQLKEISAVSVMRDIP
YLGHFRCSDTLLNKIWDTGAYTVHLNMQNYLWDGIKRDRLVWMGDLHPEVMTVATVFGAQ
DVVNRSMDLVKQTTPLPGWMNGIGSYSLWWIIIQRDWYLYTGDKEYLAEQREYLEGLLKQ
VISQTDEKGREKTGGTRFLDWPSSENQAAVDAGLQAMTIMALDAGAQLCSLLGDDSLAKE
CAQTAVKARKAASVLAKSLLKTKSEPYTPGNKQAAALLAMSGVMPAETAAERFISRGGAK
GFSTFYGYYMLDALAMAGQFDTAMDIMRTYWGGMLSVGATTFWEDFDIAWLENAARIDSP
VPAGKKDIHGNYGAYCYTGFRHSLCHGWASGPTSWLSRWVLGVRPLEAGFAAVEIEPHLG
SLQWAEGTFPTPYGVINVRHEKMQDGSVKSDVKAPEGVKVIIKQDASGKKEHRPAAIHGK
RI

Enzyme Prediction     

No EC number prediction in MGYG000000418_00022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	77	582	2.1e-110	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.51e-25	183	467	4	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.52e-09	522	579	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK91321.1	6.82e-276	19	580	19	580
QIX67104.1	6.82e-276	19	580	19	580
QKH97687.1	7.07e-276	19	582	19	582
QCY56552.1	7.07e-276	19	582	19	582
QUT19201.1	9.68e-276	19	580	19	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.05e-47	78	577	194	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	4.81e-31	150	582	504	939	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.05e-16	74	518	91	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000919	0.588290	0.409912	0.000397	0.000247	0.000218

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000418_00022.