CAZyme Information: MGYG000000418_00152

Basic Information

• Species: UBA1820 sp003150615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820; UBA1820 sp003150615
• CAZyme ID: MGYG000000418_00152
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000000418_1|CGC2	41513.06	9.52

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000418	2050770	MAG	Sweden	Europe

• Gene Location: Start: 160631; End: 161761 Strand: +

Full Sequence      

MKYYIIAGEASGDLHASNLIKELKARDGQAEIRAWGGDLMRQAGAEIVKHYRELAFMGFA
EVLANLRTILGNMKFCKRDIAAFAPDAVIFVDYPGFNLNIASWCRKNGYRTYYYISPQVW
AWKEGRVKGIKKNIDRMLVILPFEKDFYEKHRYSVDYVGHPLLDALASRPHADPDAFRSE
NGLDERPIIALLPGSRRQEIKKMLPAMASAEKKFPGYQFVVAGAPGQGEDFYDKLLKNTG
IRIVYGKTYGLLSSAHAALVTSGTATLETALIGTPEVVCYKGSPLSYMIGRMVVKVPFIS
LVNLIAGRKVVTELIQGELNAENIERELGAILSGPVREKMLEDYASIRHILGDGGASARA
AALITGYMKKNGSGGH

Enzyme Prediction     

No EC number prediction in MGYG000000418_00152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	351	1.4e-124	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.78e-133	1	373	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.43e-118	1	364	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.88e-94	4	344	2	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.11e-82	5	362	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.86e-62	1	364	2	343	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE49237.1	8.40e-167	1	370	1	371
QYJ69419.1	9.06e-166	1	369	1	370
AXG73350.1	4.92e-163	1	369	1	370
ADF51008.1	4.65e-161	1	369	1	370
AWM13386.1	9.70e-161	1	370	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.74e-48	5	343	11	356	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.63e-48	5	343	11	356	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.96e-87	5	371	8	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	5.73e-84	5	370	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	3.13e-83	5	364	9	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	2.87e-81	5	370	11	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B8JE78	1.10e-77	5	369	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000418_00152.