CAZyme Information: MGYG000000418_01142

Basic Information

• Species: UBA1820 sp003150615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; UBA1820; UBA1820; UBA1820 sp003150615
• CAZyme ID: MGYG000000418_01142
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		64213.71	6.4485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000418	2050770	MAG	Sweden	Europe

• Gene Location: Start: 43425; End: 45161 Strand: -

Full Sequence      

MKLPAYALIPAVSVFLMTACTLKPQNTSHGILPADFASIHAAGELSQRIQRNFDRLEEEY
YHPENVFWSEKESGGWPGDKEGRTILALTLNAQASGRTPKYLDTLIKMLPAHLNAKGYLG
TIHEGADEQQLSGHGWLLRGLCEYYRYTGDEKALSYAKTIADSLFLPVTPIIKDYPCLPE
DRLAEVGDMSGSAQNTVNGWRLSSDVGCVFIGMEGLIHYYSFDRDPRIKETIDSLVNLFL
GIDLVGIKAQTHASLTAVRGLLRYAEITGNDTLITEAAGRWQTYRDYGMTENYENYNWFS
RYGTWTEPCAIIDSYMAAVQLWAATRNAQYLDDAEKIYLNGMASTQRSNGGFGCDKPLGV
EYLDLSVHADEAYWCCTMRGGEGLPRAAQYSYFTAGDTIFVPFYRENTFHTGSTALSQHT
QYPFGDTVTFTVGKSGGALKTLSLRIPPYMHGPVITVNGKEIHAEIIKGFANVTRTFSPG
DTIKLRYSFRPSWEPLQNKDITDTSLHKAVYGPLVLGTASGQALNTKGLPAIERIDGTYD
FIIANTCDTLRPLYHLMDPAVSLKNKYRRAVVAKNNGL

Enzyme Prediction     

No EC number prediction in MGYG000000418_01142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	255	516	7.8e-29	0.5407554671968191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.63e-41	49	516	21	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.68e-30	54	531	36	517	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23470.1	2.66e-236	25	574	23	576
BCI61757.1	1.61e-179	14	561	15	563
QGQ98268.1	3.51e-115	41	558	10	534
QOY91325.1	6.62e-24	45	517	35	499
AHE53197.1	4.46e-17	140	523	202	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.47e-11	86	487	86	530	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.79e-10	86	487	86	530	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000418_01142.