CAZyme Information: MGYG000000419_00914

Basic Information

• Species: CAG-710 sp000432595
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-710; CAG-710 sp000432595
• CAZyme ID: MGYG000000419_00914
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		43143.4	9.181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000419	1104451	MAG	Sweden	Europe

• Gene Location: Start: 291124; End: 292203 Strand: +

Full Sequence      

MNKKRKVVVYAISKNEEKFVDRWYESMKEADAIYVLDTGSTDKTVEKLKKHGVHVVKKKI
DPWRFDSARNESLKIIPNKYDIYVCTDLDEVFLTGWRDSLLKNWQDDTTRARYNYNWQLD
EKGHPLVNFYLDKIHIREGYKWTHPVHEVLTTTKKENFVTIDGITLNHYPDTNKSRKSYL
KLLEISVRESPLDDRNMHYLGREYMYYGKWNECIDTLIKHLNMKSATWKDERCASMRFIA
RAYKNLERIEESRMWLDKAISEAPYLREPWIEKGILEYETENYKDAIYYLEKALKIKSHT
KTYINEKFSWDETPYDVLSICYFNIKNYTKSLENINKALTLNPKNERIIKNKEIVKNMI

Enzyme Prediction     

No EC number prediction in MGYG000000419_00914.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.77e-11	6	202	1	192	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	1.56e-09	239	339	7	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	5.01e-08	197	295	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	2.21e-07	268	352	2	75	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	4.74e-06	7	147	2	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58819.1	9.17e-127	6	356	5	357
AQS58818.1	3.71e-123	6	356	5	357
QOX65321.1	3.34e-121	6	359	5	360
ACV63878.1	9.52e-121	4	358	3	358
CAB1239995.1	1.73e-120	7	359	6	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000419_00914.