CAZyme Information: MGYG000000422_01034

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000000422_01034
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		50190.91	5.9626

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000422	1769950	MAG	Sweden	Europe

• Gene Location: Start: 28126; End: 29433 Strand: +

Full Sequence      

MEKINLLYDATVVCNILTKNSSRSGIFFVAYNVLLEFLKRPNYNVYLYADDLVSLRELIK
TCPEFSECKIYKFSFLQDWVSYLKHKKNQNKLNKGFGPARCIYGLLASGLKKCYFLTDGS
INLTDIDAYFSPMNAIPAFVSKNEHVKCFTMLHDVIPLARECQELKWTAKWFHKLVKSMN
SEDYYFANSEFTKQDFLKYIPKLNAEHISVVPLSTGKPYRKIVDVNEINEVKRKYNIPLD
KKYMFSLCSLNPRKNLIFSIRNFLKFTAKNKLEDYILVLGGAYFDGFEKVMNEELSEFGD
LSEKILRIGYVDDEDLSALYSGAEVFLFPSLYEGFGMPVLEAMQCGLPVICSNCTSIPEV
IGDCGIQINPHNDEEMVSAMEKMSFDKPFYDECTQKGMERAKLFTWQKCGDIITEHICGE
LNETEQNINNYSYVQ

Enzyme Prediction     

No EC number prediction in MGYG000000422_01034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	234	392	1.1e-30	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.69e-73	12	409	2	356	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	1.60e-38	167	409	126	357	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.05e-32	127	423	91	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.39e-29	240	400	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	2.90e-24	300	383	53	135	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH71729.1	8.35e-87	1	410	1	430
CBG40230.1	8.35e-87	1	410	1	430
QLI05172.1	5.78e-80	1	428	1	428
QLI05171.1	3.51e-79	1	421	1	417
ADN17822.1	2.40e-62	123	410	128	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	1.06e-13	228	407	231	411	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
5D00_A	7.67e-09	217	361	166	313	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
3S28_A	1.29e-08	241	407	572	756	Thecrystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_B The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_C The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_D The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_E The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_F The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_G The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S28_H The crystal structure of sucrose synthase-1 in complex with a breakdown product of the UDP-glucose [Arabidopsis thaliana],3S29_A The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S29_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
3S27_A	6.39e-07	241	407	572	756	Thecrystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_B The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_C The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_D The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_E The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_F The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_G The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana],3S27_H The crystal structure of sucrose synthase-1 from Arabidopsis thaliana and its functional implications. [Arabidopsis thaliana]
5I45_A	3.03e-06	287	399	76	190	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FX32	1.19e-10	240	407	575	761	Sucrose synthase 6 OS=Arabidopsis thaliana OX=3702 GN=SUS6 PE=1 SV=1
A7TZT2	1.32e-10	203	406	214	421	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
P31928	2.17e-10	241	406	483	661	Sucrose-phosphate synthase OS=Spinacia oleracea OX=3562 GN=SPS1 PE=1 SV=1
F4K5W8	3.51e-10	235	407	559	750	Sucrose synthase 5 OS=Arabidopsis thaliana OX=3702 GN=SUS5 PE=2 SV=1
Q48453	3.91e-10	199	381	128	320	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000422_01034.