CAZyme Information: MGYG000000423_00529

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UBA7001
• CAZyme ID: MGYG000000423_00529
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000000423_2|CGC1	39530.89	9.1832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000423	1728758	MAG	Sweden	Europe

• Gene Location: Start: 180945; End: 181967 Strand: -

Full Sequence      

MGHYSTALTLKKELENKNIDAEVIDFYEYIFPKARNIIYGAFNFLVSKFSSIYNFFYQIS
SNTNVTPLKRIIDKKLEILFESKELEIVVSTFPVCSNYVSLYKKSRNKNIKLYTYITDID
VNKEWITEETDMYFVGSKITKKQLENYDVNSEKIKVVGIPVKQEFKKNLYSKCKNEILIM
GGGLGLLPNIDKIIKELISNKNIHVTLIAGKNKKLFYKYNEKYNNLSVVGYTNEVYKYME
KAEIIITKAGGITLFEAINSQTPIYVISPFLYQEVGNAMYIEKEGIGIINWNDNESVATD
IINLLNYPMKLERMKRNMRKITNNLENTNILNTYLEEKIC

Enzyme Prediction     

No EC number prediction in MGYG000000423_00529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	177	322	2e-25	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.00e-66	1	321	10	346	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	4.13e-38	2	337	17	368	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	3.59e-25	86	320	106	351	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	6.98e-22	2	321	12	338	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	7.95e-17	1	321	10	338	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI74019.1	2.45e-104	1	326	1	331
QAT42965.1	2.10e-100	1	334	12	350
QSX05871.1	2.44e-95	1	331	12	362
AXU80307.1	1.10e-82	1	340	12	361
CDS88344.1	1.10e-82	1	340	12	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R9F0	1.27e-35	2	337	17	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) OX=412694 GN=ugtP PE=3 SV=1
B7IW03	1.77e-35	2	321	17	352	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain G9842) OX=405531 GN=ugtP PE=3 SV=1
Q73DZ5	3.43e-35	2	337	17	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=ugtP PE=3 SV=1
Q81YW9	9.22e-35	2	337	17	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus anthracis OX=1392 GN=ugtP PE=3 SV=1
C3PCX2	9.22e-35	2	337	17	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus anthracis (strain A0248) OX=592021 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999892	0.000105	0.000003	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000423_00529.