CAZyme Information: MGYG000000423_01552

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UBA7001
• CAZyme ID: MGYG000000423_01552
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		70771.29	5.9025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000423	1728758	MAG	Sweden	Europe

• Gene Location: Start: 11536; End: 13359 Strand: -

Full Sequence      

MNKIKNIYNQIKFYFKKYGFWATVKKCLKKIITKDPVRDSERANYQEWIRQNEPNEEELK
AQRNHKFKIEPKISIVVPMYNTKEEFFKDLVNCLKNQTYSNWELCLADGSPKTNENLKKY
YEDDERIKYKLLESNEGISGNTNEALKMVTGDYIGLLDHDDAIPIFALYEIVKCINENPE
VEFIYTDEDKIENTLENRCDPHFKPDFAPDTLSANNYITHFVIMKKELMVDKIGGFRDEY
NGAQDFDLVLRASELTKNIVHISKVLYHWRVHNESTAKVADAKPYAYEAGKRAAQDHITR
MGRKGTADFGNDIPGVYEIEYDVIGNPKVNILIPNKDGIKFLKKCVNSILEKTTYKNYEI
DIIENNSEEKETFEYYEELKKNDKIKILTYPEKGFNYSKIINYGVKNVDGEFVMQLNNDT
ELLTPNWLEKFIGYAQREDVGAVGARLYYGDKSIQHAGIAYGICGLAANLMPGVPYGSHG
YFGRECLTQNLSAVTGACLFSKRSIYEEVGYMEEELFKVAFNDVDFCLKIREKGYLIVYN
PYIELMHYESKTRGYENTPEKQERFERECNNFKTKWKDLLSKPDPYLNINFSRNTALYNV
RTDKVEY

Enzyme Prediction     

No EC number prediction in MGYG000000423_01552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	74	186	6.9e-25	0.6764705882352942
GT2	331	509	5.1e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.21e-99	71	271	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	9.03e-32	331	549	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	5.09e-22	74	179	1	107	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.25e-19	325	554	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.36e-19	74	276	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE14040.1	5.02e-204	14	592	379	951
AWB09765.1	6.72e-197	14	592	169	751
BAV13183.1	1.11e-193	3	600	206	795
ADL50381.1	1.11e-193	3	600	206	795
CDM69534.1	1.84e-190	4	592	178	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	1.39e-13	71	304	375	604	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.39e-13	71	304	374	603	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.32e-122	71	577	366	875	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.64e-85	43	560	291	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q8L0V4	8.22e-13	71	304	432	661	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
Q58457	7.43e-10	71	287	8	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q0P9C6	2.15e-08	71	177	2	110	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000423_01552.