CAZyme Information: MGYG000000424_00096

Basic Information

• Species: CAG-353 sp900768995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900768995
• CAZyme ID: MGYG000000424_00096
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000000424_1|CGC2	54941.14	9.4368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000424	2854163	MAG	Sweden	Europe

• Gene Location: Start: 113521; End: 115035 Strand: -

Full Sequence      

MKRLMSLLISAAMILSTGASVSAADAEVSSPWKTITISEELAAKKTTASTKEVKVTSVKV
SESEITLKKGETYTIKATIAPKDASNKKVTYSSSNKNVAKVSSKGVITAVKNGTATITVK
AADGSGKKAVITVTVSSKKASSDKTTDTKTNGKKTNAKATNGFDTKKTSMDIVKEMGAGW
NLGNSLDALGTGLASETAWGNPKTTKKMIDDICGAGIKTIRIPVSWGKHCDAKGNVDKEW
MKRVKEVVDYAYDNGVYVILNSHHDNTYYDIGGCVKSDDTLNSSVKKMNKLWTQIANEFK
DYDEHLIFETLNEPRTEGSAKEWSGGTAEEREVVAKLNEEIVKTIRSTGGNNAYRQIMVP
AYAATSSTNILKQMKVPDDDNIIVSVHAYNPYFFAMDANGSNKFSDSDKKELDRFFKDLN
SIFVSKGTPVVIGEFGATNKKNLDDRVAWAEYYVKGAKQYNIPCVLWDNNSGRQSGGECF
GVYSRDRQEFTYPEIVEAIVKAAK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	195	470	1.8e-100	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.76e-75	191	471	11	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.79e-43	164	470	39	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG5492	YjdB	5.98e-15	53	169	179	294	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	4.81e-14	56	131	1	76	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
smart00635	BID_2	6.25e-10	55	131	2	81	Bacterial Ig-like domain 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDM69884.1	2.01e-110	167	500	38	375
AAC37035.1	2.48e-110	167	504	37	379
ADK66823.1	3.76e-102	168	501	32	364
CCO06082.1	2.58e-101	165	499	51	378
CDE11886.1	4.46e-101	168	504	380	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q1I_A	4.72e-113	167	504	12	354	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
6XSU_A	1.73e-98	168	485	12	333	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
6WQP_A	6.45e-98	168	501	15	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
3NDY_A	6.82e-98	169	501	12	339	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6PZ7_A	2.78e-97	168	500	8	334	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	4.96e-111	167	504	37	379	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P16216	7.17e-96	165	497	65	392	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P28623	1.13e-95	169	501	43	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P23661	1.56e-95	165	504	67	401	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P23660	2.16e-95	168	504	26	364	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999121	0.000158	0.000184	0.000152	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000424_00096.